SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000009891 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000009891
Domain Number 1 Region: 234-467
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.49e-74
Family Nuclear receptor ligand-binding domain 0.000000000754
Further Details:      
 
Domain Number 2 Region: 99-183
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.14e-27
Family Nuclear receptor 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000009891   Gene: ENSPVAG00000010498   Transcript: ENSPVAT00000010497
Sequence length 468
Comment pep:known_by_projection scaffold:pteVam1:scaffold_11196:21321:37999:-1 gene:ENSPVAG00000010498 transcript:ENSPVAT00000010497 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDTESPICPLSPLEADDLESPLSEEFLQEMGTIQEISQSMCEDSSGSFSFTEYQYLGSG
PGSDGSVITDTLSPASSPSSVTYPMAPGSADESSSAALNIECRICGDKASGYHYGVHACE
GCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQHCRFHKCLSVGMSHNAIRYGRMPRSE
KAKLKAEILTCEHDIEDSEMADLKSLAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPFV
IHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKSIPGFANL
DLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGSGFITREFLKSLRKPFCDIMEPKFD
FAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLKLHLQSNHPDDT
FLFPKLLQKMADLRQLVTEHAQLVQVIKKTESDAALHPLLQEIYRDMY
Download sequence
Identical sequences ENSPVAP00000009891 ENSPVAP00000009891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]