SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000010038 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000010038
Domain Number 1 Region: 7-31,79-147
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.71e-22
Family Voltage-gated potassium channels 0.0039
Further Details:      
 
Domain Number 2 Region: 140-265
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.09e-21
Family Voltage-gated potassium channels 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000010038   Gene: ENSPVAG00000010654   Transcript: ENSPVAT00000010654
Sequence length 503
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_2722:23151:57708:-1 gene:ENSPVAG00000010654 transcript:ENSPVAT00000010654 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDRGPLLTSAIIFYLAIGAAIFEVLEEPHWKEAKKNYYTQKLHLLKEFPCLGQEGLDKI
LQVVSDAAGQGVAITGNQTFNNWNWPNAVIFAATVITTIGYGNVAPKTPAGRLFCVFYGL
FGVPLCLTWISALGKFFGGRAKRLGQFLMKRGVSLRKAQITCTAIFIVWGVLVHLVIPPL
VFMVTEEWDYIEGFYYSFTTISTIGFGDFVAGVNPSANYHALYRYFVELWIYLGLAWLSL
FVNWKVSMFVEVHKAIKKRRRRRKESFESSPHSKKALQIAGNTASKDINIFSFLSKKEET
YNDLIKQIGKKAMKTSGGGKRVPGLGPGPGPGPQESGLPAIPASLPLMVLYSRTRVPSLE
EVSQTLRSKGHVSRAPGEEARAGPPEDGSPTPEVFTNQLDRISEEGEPWDAQDYHPLIFQ
NANITFVNEETSLLDEETSKSSLEDNLAGEERPQEEAEAEVPLNLGELPSSDESTFTSTE
SEVSVPYEQLMNEYNKANGPRDT
Download sequence
Identical sequences ENSPVAP00000010038 ENSPVAP00000010038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]