SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000010334 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000010334
Domain Number 1 Region: 227-478
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.09e-56
Family Voltage-gated potassium channels 0.00083
Further Details:      
 
Domain Number 2 Region: 7-39,92-162
Classification Level Classification E-value
Superfamily POZ domain 4.71e-28
Family Tetramerization domain of potassium channels 0.0000332
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000010334   Gene: ENSPVAG00000010964   Transcript: ENSPVAT00000010964
Sequence length 640
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_2796:33935:132198:-1 gene:ENSPVAG00000010964 transcript:ENSPVAT00000010964 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKIENNERVILNVGGTRHETYRSTLKTLPGTRLALLAASEPQGDCLTAAGDKPQPSSPS
LSPSPRPPPLSPGPGGCFEGGAGNCSSHGGGGGGGDHPGGGREFFFDRHPGVFAYVLNYY
RTGKLHCPADVCGPLFEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDIFETPDLIGGD
PGDDEDLAAKRLGIEDAGGLGMPDGKSGRWRRLQPRMWALFEDPYSSRAARFIAFASLFF
ILVSITTFCLETHEAFNIVKNKTEPVINGTSVVLQYEIETDPALTYVEGVCVVWFTFEFL
VRIVFSPNKLEFIKNLLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRI
FKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERVGAQPNDPSASEH
TQFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGM
YYSLAMAKQKLPRKRKKHIPPAPQASSPTFCKTELNMACNSTQSDTCLGKDNRLLEHNRS
VLSGDDSTGSEPPLSPPERLPIRRSSTRDKNRRGETCFLLTTGDYACASDGGIRKGYEKS
RSLNNIAGLAGNALRLSPVTSPYNSPCPLRRSRSPIPSIL
Download sequence
Identical sequences ENSPVAP00000010334 ENSPVAP00000010334 XP_006923818.1.64745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]