SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000011473 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000011473
Domain Number 1 Region: 893-1074
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.02e-40
Family Ypt/Rab-GAP domain of gyp1p 0.0055
Further Details:      
 
Domain Number 2 Region: 1049-1170
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.14e-33
Family Ypt/Rab-GAP domain of gyp1p 0.0039
Further Details:      
 
Domain Number 3 Region: 191-221,314-443
Classification Level Classification E-value
Superfamily PH domain-like 2.97e-28
Family Phosphotyrosine-binding domain (PTB) 0.0064
Further Details:      
 
Domain Number 4 Region: 31-185
Classification Level Classification E-value
Superfamily PH domain-like 2.32e-21
Family Phosphotyrosine-binding domain (PTB) 0.0098
Further Details:      
 
Weak hits

Sequence:  ENSPVAP00000011473
Domain Number - Region: 1174-1257
Classification Level Classification E-value
Superfamily Tropomyosin 0.0981
Family Tropomyosin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000011473   Gene: ENSPVAG00000012170   Transcript: ENSPVAT00000012171
Sequence length 1300
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_1647:8539:161297:-1 gene:ENSPVAG00000012170 transcript:ENSPVAT00000012171 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPPSCIQEEPFAHPLEPEPGAPAQPGPGKPGDKRFRLWYVGGSCLDRRTTLPMLPWLMA
EIRRRSQKPEAGGCGAPAAREVLLVLSAPFLRCVPAPGAGAAVGSGPAAAQPNPAVFIFE
HKAQHISRFIHNSQDLTYFAYLIKAQPDDPESQMVCHVFRAIDPNQVPDVISSIRQLSKA
AMKEDAKPSKDNEDAFYNSQKFEVLYCGKVTVTHKKAPSSLIDDCIEKFSLHEQQRLRIQ
GEQRGPDARNDPVAFEVEGPSSLTDILLEEGDVVNYTLPALPATASQPGLSSSRICFPEM
ILEDSGFDEQQEFRSRCSSVTGVLQKKVHENSQKPQPRRRHASAPSHVQPSDSEKNRTML
FQVGRFEINLISPDTKSVVLEKNFKEISSCSQGIKHVDHFGFICRESPEPGLSQYICYVF
QCASESLVDEVMLTLKQAFSTAAALQSAKTQIKLXXXXXXXXXXXXXXXXXXLYPPRAKL
VIQRHLSSLSDNEQADIFERVQKMKPVNDQEENELVILHLRQLCEAKQRTHVHIGEGPST
ILNSTIPENTASSGRFKLDILKNKAKRSFTSSLENIFSRGANRMRGRLGSMDSFERSNSL
ASEKDYSPGDSPPGTPPASPLSSAWQTFPEEDSDSPQFRRRAHTFSHPPSSTRRKLNLQD
GRAHSVRSPLLRQSSIEQCSILPSVRRMHKESYSSSSLPSLHTSFSAPSFTAPSFLKSFY
QNSGRLSPQYENEIRQDTASESSDGEGRKRTSSTCSNESLNIGGTPVTPRRISWRQRIFL
RVASPMNKSPSAMQQQDGLDRNELLPLSPLTPTMEEEPLVIFMSGGDDPEKVRERKKSEE
LRALWRKAIHQQILLLRMEKENQKLEASRDELQSRKVKLDYEEVGVCQKEVLITWDKKLL
NYRAKIRCDMEDIHTSLKEGVPKSRRGEIWQFLALQYRLRHRLPNKQQPPATSYKELLKQ
LTAQQHAILVDLGRTFPTHPYFSAQLGAGQLSLFNLLKAYSLLDKEVGYCQGISFVAGVL
LLHMSEEQAFEMLKFLMYDLGFRKQYRPDMMSLQIQMYQLSRLLHDYHRDLYNHLEENEI
SPSLYAAPWFLTLFASQFPLGFVARVFDIIFLQGTEVIFKVALSLLSSQETLIMECENFE
SIVEFLKSSLPDMNTTEMEKIITQVFEMDISKQLHAYEVEYHVLQDELHESSYAFEDSEP
VEKLERANNQLKRQNMDLLEKLQIAHAKIQTLESNLENLLTRETKMKSLIRTLEQEKMAY
QKTVEQIRKLLPADALANCESLLRDLNSNPNNKAKTGNKP
Download sequence
Identical sequences ENSPVAP00000011473 ENSPVAP00000011473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]