SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000011855 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000011855
Domain Number 1 Region: 42-131
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.29e-36
Family SCAN domain 0.0000526
Further Details:      
 
Domain Number 2 Region: 161-220
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-20
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 3 Region: 457-508
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.08e-18
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 4 Region: 359-411
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.28e-18
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 5 Region: 396-448
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000191
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000011855   Gene: ENSPVAG00000012576   Transcript: ENSPVAT00000012574
Sequence length 514
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_2156:6666:19608:1 gene:ENSPVAG00000012576 transcript:ENSPVAT00000012574 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPLNNLMAISKPENPALCEQSDVLRANLSWQQETIPVMETYNSEASRRKFRHFQYLEVS
GPQEALSQLWELCLQWLRPEIHTKKQILELLVLEQFLTILPEEVRTWVNLQHPKSSKEVV
TLIEDVIEMLKDKDIPCKDSVLLQKGSIKEKKEADSLTGKFQEPVTFKDVVVEFSEEEWG
HLDPAVKSLYRDVMLENYRNLNSLRKEHLFSKPDEVPKLECKKKRWITEQEIPRTIVFDM
KQRISGEESSHGVIMTRLTQSGPSIAWKSDDWDHWDINLPQGAFIHKTVYTEEGDFECSE
NKNFDVKSVNLVFDKQQGIPMRKESLKCDKFKTQFKFNLDSVGKQHSEYNECESAMRLSI
DIRHPKSHTTMNSYECYQCGKAFSRSSSLIRHQIIHTGEKPYKCSECGRFFNRRTNLTKH
QKLHTEAKAYEGNKCGITFSKSEDSNKHPSLHPGDNAYECVNCGKSFNRSSSLIRHQMIH
TGEKPFKCKECEKTFNRSSNLTKHQKLHTREKSY
Download sequence
Identical sequences ENSPVAP00000011855 ENSPVAP00000011855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]