SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000011945 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000011945
Domain Number 1 Region: 213-468
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.44e-50
Family Voltage-gated potassium channels 0.0016
Further Details:      
 
Domain Number 2 Region: 52-159
Classification Level Classification E-value
Superfamily POZ domain 3.4e-25
Family Tetramerization domain of potassium channels 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000011945   Gene: ENSPVAG00000012666   Transcript: ENSPVAT00000012666
Sequence length 529
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_2840:155684:160033:-1 gene:ENSPVAG00000012666 transcript:ENSPVAT00000012666 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTLPVQGTHFENYWSILMLPKTLGGRRAAAMVSESPRPGARVPWRRRDEALRVNVGGVR
RRLSARALARFPGTRLGRLQAAASEEQARRLCDDYDPAAREFYFDRHPGFFLGLLHFYRT
GRLHVLDELCVFAFGQEADYWGLGESALATCCRARYLERRVARPRAWDEDSDTPSSVDPC
PGEISDVQRELARYGAARCGRLRRRLWLTMENPGYSLPSKLFSCVSIGVVLASIAAMCIH
SLPEYQAREAAAALAAVAAGRSAEDVRDDPVLRRLEYFCIAWFSFEVSSRLLLAPSTRNF
FCHPLNLIDIVSVLPFYLTLMAGAALGDQGGASGEELGDLGKVVQVFRLMRIFRVLKLAR
HSTGLRSLGATLKHSYREVGILLLYLAVGVSVFSGVAYTAEKEEDVGFDTIPACWWWGTV
SMTTVGYGDVVPVTVAGKLAASGCILGGILVVALPITIIFNKFSHFYRRQKALEAAVRNS
GHQEFEDLLSSVDGVSEGSLETSRDTSQEGRSADLEAQDPSRPPNSHIY
Download sequence
Identical sequences ENSPVAP00000011945 ENSPVAP00000011945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]