SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000012512 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000012512
Domain Number 1 Region: 381-642
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 8e-56
Family Nuclear receptor ligand-binding domain 0.0000000194
Further Details:      
 
Domain Number 2 Region: 336-386
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000224
Family Nuclear receptor 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000012512   Gene: ENSPVAG00000013267   Transcript: ENSPVAT00000013267
Sequence length 644
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_1161:126177:155805:1 gene:ENSPVAG00000013267 transcript:ENSPVAT00000013267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
THDSIRFGNVDMPCVQAQYSPSPPGSSYAAQTYGSEYTAEIMNPDYAKLTMDLGTTEITA
TATTSLPSFSTFMEGYSSNYELKPSCLYQMQPSGPRPLIKVEEGRAHGYHHHPHHHSHHH
SHHHHHHQQQQQQPSIPPPSGPEDEVLPSTSMYFKQSLPSTPTTPGFPPQAGALWDDSLS
SASSCIAPGPLLDPTMKAVPSVPGARIPLFHFKSSLPDPPAHNTDGSHHLSYEPTAASAL
SLPLRAASAGSQTTALEGHPYGLPLAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTVQKNAKYVCLANKNCPVDKRRRN
RCQYCRFQKCLSVGMVKEVVRTDSLKGRRGRLPSKPKSPLQQEPSQPSPPSPPICMMNAL
VRALTDSTPRDLDYSRYCPTDQAAAGTDAEHVQRFYNLLTASIDVSRSWAEKIPGFTDLP
KEDQTLLIESAFLELFVLRLSIRSNTAEDKFVFCNGLVLHRLQCLRGFGEWLDSIKDFSL
SLQSLNLDIQALACLSALSMITERHGLKEPKRVEELCNKITSSLKDHQSKGQALESTETK
VLSALVELRKICTLGLQRIFYLKLEDLVSPPSIIDKLFLDTLPF
Download sequence
Identical sequences ENSPVAP00000012512 ENSPVAP00000012512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]