SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000013055 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000013055
Domain Number 1 Region: 91-174
Classification Level Classification E-value
Superfamily HMG-box 3.93e-23
Family HMG-box 0.0000242
Further Details:      
 
Domain Number 2 Region: 214-310
Classification Level Classification E-value
Superfamily HMG-box 1.23e-19
Family HMG-box 0.0000374
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000013055   Gene: ENSPVAG00000013843   Transcript: ENSPVAT00000013843
Sequence length 391
Comment pep:novel scaffold:pteVam1:scaffold_43565:477:1654:1 gene:ENSPVAG00000013843 transcript:ENSPVAT00000013843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESTNSRDHWSKEDVVTLLDCMEDNLPSHDNHTFKTTQSYMDWEKVAFKDHSGEMCKLKW
LEISYNIRKVRTLTELVLEAKERVNNLHKSKKCRKHPDLPKKPMTAYFRFFKEKRPQYAQ
KHPGLNNKELTKVLSEEYKKLPEQVKLKYIQDFQKEKQEFEEKLAQFRKEHPDLVQNSKK
SVVPMRRPTRAQKKFQRNVREVKSPTESYFSMRMKFNGEPRKPPMNEYHKFQQDLWESRE
LQDLPLRERMVEIGRRWQRIPWSQKEHYKRQAEELQKQYKVDLDRWLRSLSPEEYAAYRE
RTYTKYKNMNMNGGPDPSMSPTDLQSPSARSLQAGLGQEQGLQAPEIESSKAVGGHSHAP
WGSEENQEDGRQVGGSSSSGSSSADEDEDCV
Download sequence
Identical sequences ENSPVAP00000013055 ENSPVAP00000013055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]