SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000013434 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000013434
Domain Number 1 Region: 469-755
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.46e-62
Family Nuclear receptor ligand-binding domain 0.00000000204
Further Details:      
 
Domain Number 2 Region: 415-498
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.36e-25
Family Nuclear receptor 0.0000139
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000013434   Gene: ENSPVAG00000014255   Transcript: ENSPVAT00000014255
Sequence length 775
Comment pep:known_by_projection scaffold:pteVam1:scaffold_4498:8384:91565:-1 gene:ENSPVAG00000014255 transcript:ENSPVAT00000014255 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPKESLSPPSREEIPSSVLGRERGNVMDFYKTLRGGATVKVSASSSSLAAASQSDSKQQ
RLLVDFPKGSGSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDF
RLLEESIANLNKSTSVPENPKSSASAAVSAAPTEEFPKTHSDVSSEQQNLKSQTGTNGGN
VKLYNTDQRTFDILQLEFSSGSPGKETNESPWRSDLLIDDNCLLSPLTGEDDPFLLGNSN
EDCKPPCLPDTKPKIKDNGDLILSSPSSVTLPQVKTEKEDFIELCTPGVIKQEKLGPVYC
QAGFSGANIIGNKISAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPVFNVIPPIPAGSE
NWNRCQGSGDDNLTSLGTLNFPGRSVFSNGYSSPGMRPDVSSPPSSSSAAAGPPPKLCLV
CSDEASGCHYGVLTCGSCKVFFKRAMEGRQHNYLCAGRNDCIIDKIRRKNCPACRYRKCL
QAGMNLEARKTKKKIKGIQQATTGISQETSENPANKTIVPATLPQLTPTLVSLLEVIEPE
VLYAGYDSSAPDSTWRIMSTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMILLQYSWMF
LMAFALGWRSYRQSSANLLCFAPDLIINEQRMALPCMYDQCKHMLFVSSELNRLQVSYEE
YLCMKTLLLLSSVPKEGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLL
DSMHEVVENLLHYCFQTFLDKSMSIEFPEMLAEIITNQLPKYSSGNIKKLLFHQK
Download sequence
Identical sequences ENSPVAP00000013434 ENSPVAP00000013434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]