SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000013488 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000013488
Domain Number 1 Region: 485-534
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000254
Family Classic zinc finger, C2H2 0.0025
Further Details:      
 
Domain Number 2 Region: 720-775
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000752
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 3 Region: 87-130
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000125
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 4 Region: 538-565
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000312
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 5 Region: 628-656
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000142
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 581-618
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000039
Family Classic zinc finger, C2H2 0.058
Further Details:      
 
Domain Number 7 Region: 783-807
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000728
Family Classic zinc finger, C2H2 0.043
Further Details:      
 
Weak hits

Sequence:  ENSPVAP00000013488
Domain Number - Region: 179-314
Classification Level Classification E-value
Superfamily Trimeric LpxA-like enzymes 0.000259
Family Galactoside acetyltransferase-like 0.069
Further Details:      
 
Domain Number - Region: 137-169
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00364
Family Classic zinc finger, C2H2 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000013488   Gene: ENSPVAG00000014313   Transcript: ENSPVAT00000014312
Sequence length 890
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_3826:19170:24634:-1 gene:ENSPVAG00000014313 transcript:ENSPVAT00000014312 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADPFCVGASRRLPGSSKSGPGKDGNRNEVRLPVHDPPKLXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXLSLMNQWKDEFKAHSRVKCPNSGCWLEFPSIY
GLKYHFQRCQGGAISERLTFPCPFCEAAFTSKTQLEKHRIWNHMDRPLPAPKPGPVSRPV
TISRPVGVSKPIGVSKPVTIGKPVGVSKPIGISKPVTVSRPVPVTKPVTVSRPVPVTKPV
TVSRPVPVSKPVTVSRPMSVTKAVPVTKSVPVTKPVTMTKLVTVTKPVPVTKPVTVSRPI
VVSKLVTVSRPIAISRHTPSCKMVLLTKSENKTRAAGRSSGKKRAADGLVACPIPPKQTR
PENGEHGPSTLGQSSAFQLGTDPSGGPLSMGNRPSGGKEAPRAPGPVSPTEEGAERTKHR
RKQKTPKKFTGEQPSISGTFGLKGLVKAEDKSRSYRARKQDGPSPEDVRKKAPAPASTVS
KEVPAPTAHLAPGGPEEQWQRAIHERGEAVCPTCSVVTRKTLVGLKKHMEVCQKLQDALK
CQHCRKQFKSKAGLNYHTMAEHSAKPSDTEASEGSEQEERERLRKVLKQMGRLRCPQEGC
GAAFSSLMGYQYHQRRCGKPPCEVDSPSFPCAHCGKTYRSKAGHDYHVRSEHAAPPPEEP
EDKPPESEDLLGVERTPSGRIRRTSAQVAVFHLQEIAEDELARDWTKRRMKDDLVPETAR
LNYTRPGLPTLNPQLLEAWKSEVKEKGHVNCPNDCCGAIYSSVSGLKAHLAGCSKGDHLV
GKYGCLLCAKEFSSESGVKYHILKAHAENWFRTSADPPPKHRSQDSLVPQKEEKSLAGGR
KRGRKPKERPPEEPAPRTPPRQDDWPPGGRDKGVRGSAGRKVGAGKAPEK
Download sequence
Identical sequences ENSPVAP00000013488 ENSPVAP00000013488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]