SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000014333 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000014333
Domain Number 1 Region: 1258-1523
Classification Level Classification E-value
Superfamily YWTD domain 9.81e-51
Family YWTD domain 0.00000237
Further Details:      
 
Domain Number 2 Region: 1878-2100
Classification Level Classification E-value
Superfamily YWTD domain 5.23e-45
Family YWTD domain 0.0000173
Further Details:      
 
Domain Number 3 Region: 1573-1829
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-43
Family YWTD domain 0.0000219
Further Details:      
 
Domain Number 4 Region: 203-466
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-43
Family YWTD domain 0.0000502
Further Details:      
 
Domain Number 5 Region: 3009-3262
Classification Level Classification E-value
Superfamily YWTD domain 4.05e-39
Family YWTD domain 0.0000242
Further Details:      
 
Domain Number 6 Region: 2187-2451
Classification Level Classification E-value
Superfamily YWTD domain 4.19e-29
Family YWTD domain 0.0001
Further Details:      
 
Domain Number 7 Region: 3883-4101
Classification Level Classification E-value
Superfamily YWTD domain 3.66e-25
Family YWTD domain 0.00023
Further Details:      
 
Domain Number 8 Region: 2920-3001,3255-3316
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.82e-24
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 9 Region: 875-920
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000131
Family LDL receptor-like module 0.00069
Further Details:      
 
Domain Number 10 Region: 918-958
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 11 Region: 840-879
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000275
Family LDL receptor-like module 0.00047
Further Details:      
 
Domain Number 12 Region: 3623-3659
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000034
Family LDL receptor-like module 0.00084
Further Details:      
 
Domain Number 13 Region: 1174-1252,1523-1567
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000392
Family Growth factor receptor domain 0.0084
Further Details:      
 
Domain Number 14 Region: 3749-3789
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000393
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 15 Region: 2884-2925
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000432
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 16 Region: 2753-2789
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000524
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 17 Region: 3461-3501
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000694
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 18 Region: 3583-3621
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000733
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 19 Region: 963-1001
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000838
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 20 Region: 1002-1038
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000119
Family LDL receptor-like module 0.0003
Further Details:      
 
Domain Number 21 Region: 1050-1086
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.00055
Further Details:      
 
Domain Number 22 Region: 2796-2831
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000301
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 23 Region: 2712-2750
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000419
Family LDL receptor-like module 0.00077
Further Details:      
 
Domain Number 24 Region: 2539-2580
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000524
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 25 Region: 3307-3342
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000668
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 26 Region: 3426-3462
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000942
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 27 Region: 145-192
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000128
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 28 Region: 3385-3422
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 29 Region: 2633-2669
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000458
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 30 Region: 2833-2873
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000119
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 31 Region: 3348-3382
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000183
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 32 Region: 2504-2541
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000406
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 33 Region: 1132-1168
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000615
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number 34 Region: 1096-1129
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000772
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 35 Region: 74-107
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000236
Family LDL receptor-like module 0.0036
Further Details:      
 
Domain Number 36 Region: 3707-3743
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000432
Family LDL receptor-like module 0.0035
Further Details:      
 
Domain Number 37 Region: 2142-2191
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000045
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 38 Region: 796-832
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000479
Family EGF-type module 0.019
Further Details:      
 
Domain Number 39 Region: 4380-4420
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00001
Family EGF-type module 0.04
Further Details:      
 
Domain Number 40 Region: 3787-3874
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000188
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 41 Region: 31-67
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000563
Family LDL receptor-like module 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSPVAP00000014333
Domain Number - Region: 4207-4242
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000162
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 4280-4315
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000282
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 4244-4277
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000419
Family EGF-type module 0.011
Further Details:      
 
Domain Number - Region: 732-790
Classification Level Classification E-value
Superfamily YWTD domain 0.000536
Family YWTD domain 0.0032
Further Details:      
 
Domain Number - Region: 481-515
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00706
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 4317-4349
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0393
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 2458-2519
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0789
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000014333   Gene: ENSPVAG00000015191   Transcript: ENSPVAT00000015206
Sequence length 4591
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_2907:57809:1276390:-1 gene:ENSPVAG00000015191 transcript:ENSPVAT00000015206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEFVLALLTLSGLLPIAKVLTVGADGDQQLCDPGEFLCHDHVTCVSQSWLCDGDPDCDD
DESLDTCPEEVEIKCPLNHIACLGAKKCVHLSQLCNGVLDCSDGYDEGVHCRELLPNCQQ
LNCQYKCAIVRNSTRCYCEDGFEVTEDGRSCNDQDECAIYGTCSQTCRNTYGSYACSCVE
GYIMQPDNRSCKVKNEPADSPPMLLIANSEIIEVFYLNGSKMATLSSVNGNEIHTLDFIY
NEDMICWIESRESSNQLKCIQITRTGRLTDEWTINIIQSFHNVQHMAIDWLTRNLYFVDH
ISDRIFVCNYNGSVCVTLIDLELHNPKAIAVDPIAGKLFFTDYGNIAKVERCDMDGTNRT
RIIDSKTEQPAALALDLVNKLVYWVDLYLDYVEVVDYQGKNRHTIIQGRQVRHLYGITVF
EDYLYVTNSDNFNIIRINRFNGTDIYSLIKMENARGIRIYHKRTQPTVRSHACEVDPYGM
PGGCSHICLLSSSYKTRTCRCRTGFNLGSDGRSCKXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXIVYSGKELNHPFGLSHYGNYVFWTDYMNGSIFQLDLITNEVTLLRHERPPLF
GLQIYDPRKQQGDNMCRINNGGCSTLCLAIPGGRVCACADNQLLDENGTTCTFNPGEILP
HICKPGEFRCKNRHCIQARWKCDGDDDCLDGSDEDSVNCSNHSCPDDQFKCKNNRCIPKR
WLCDGANDCGSNEDESNQTCAVRTCQVDQFSCGNGRCIPRAWLCDREDDCGDQTDEMASC
EFPTCEPLTQFICKSGRCISSKWHCDSDDDCGDGSDEVGCVHSCFDNQFQCSSGRCIPGH
WACDGDNDCGDFSDETQINCTKEEIRSPVGCNVNEFQCHPDGNCIPDLWRCDGEKDCEDG
SDEKGCNGTLRLCDHKTKFSCRSTGRCINKAWVCDGDIDCEDQSDEDDCDSFLCGPPKYP
CANDTSVCLQPEKLCNGRKDCPDGSDEGDLCDECSLNNGGCSNHCSVVPGRGIVCSCPEG
LQLNKDNKTCEIVDYCSSHLKCSQVCEQHKHTVKCSCYEGWKLDVDGESCTSVDSFEAFI
IFSIRHEIRRIDLHKRDYSLLVPGLRNTIALDFHFNQSLLYWTDVVEDKIYRGKLSESGG
VSAIEVVVEHGLATPEGLTVDWIAGNIYWIDSNLDQIEAAKLDGSLRTTLIAGAMEHPRA
IALDPRYGILFWTDWDANFPRIESASMSGAGRKTIYKDMKTGAWPNGLTVDHFEKRIVWT
DARSDAIYSALYDGTGMIEIIRGHEYLSHPFAVSLYGSEVYWTDWRTNTLSKANKWTGQN
VSVIQKTSAQPFDLQIYHPSRQPQAPNPCAANDGKGPCSHMCLINHNRSAACACPHLMKL
STDKKTCYEMKKFLVYARHSEIRGVDIDNPYFNFITAFTVPDIDDVTVIDFDASEERLYW
TDIKTQTIKRAFINGTGLETVISRDIQSIRGLAVDWVSRNLYWISSEFDETQINVARLDG
SLKTSIIHGIDKPQCLAVHPVRGKLYWTDGNTINMANMDGSNSKILFQNQKEPVGLSIDY
VENKLYWISSGNGTINRCNLDGGNLEVIESMKEELTKATALTIMDKKLWWADQNLAQLGT
CSKRDGRNPTVLRNKTSGVVDMKVYDKEAQQXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXIESFLMYSVHEGIRGIPLEPSDKMDALMPISGASFAVGIDFHAEND
TIYWTDMGFNKISRAKRDQTWKEDIITNGLGRVEGIAIDWIAGNIYWTDHGFNLIEVARL
NGSFRYVIISQGLDQPRSIAVHPEKGYLFWTEWGQMPCIGKAHLDGSEKVVLVSMGIVWP
NGISIDYEENKLYWCDARTDKIERIDLETGGNREMVLSGSNVDMFSVVVFGAYIYWSDXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTNVCAKDNGGCQQLCLYRG
NSQRTCACAHGYLAEDGVTCLRHEGYLLYSGRTILKSIHLSDETNLNSPVRSYENPHYFK
NVIALAFDYSQRRRGTNRIFYSDAHFGNIQLIKDNWEDRQVIIENVGSVEGLAYHRAWDT
LYWTSSTTSSITRHTVDQTRPGAFVREAVITMSEDDHPHVLALDECQNLMFWTNWNEQHP
SIMRSTLTGKNAQVVVSTDILTPNGLTIDHRAEKLYFSDGSLGKIERCEYDGSQRHVIVK
SGPGTLAVYDNYIFWPDWGRRAILRSNKYTGGDTKVLRDIPHQPMGIVAVANDTNSCELS
PCALLNGGCHDLCLLTPNGRVNCSCRGDRILLDDNRCVTKNSSCNIYSEFECGNGECIDY
QLSCDGIPHCKDKSDEKLLYCENRSCRRGFKPCYNRRCIPHGKLCDGENDCGDNSDELDC
KXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNTDCTYFYKLGVKTTGFIRC
NSTSLCVLPAWICDGSNDCGDYSDELKCPVQNKHKCEENYFGXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXSSCSWNQFACSSQKCISKHWICDGEDDCGDGLDESDSICGAITCAADMF
SCQGSHACVPRHWLCDGERDCPNGSDELSIAGCAPNNTCDENAFMCHNKVCIPKQFVCDY
DDDCGDGSDEALQCGYRQCTAEEFSCADGRCLLNTQWQCDGDFDCPDHSDEAPLNPKCKS
AEQSCNSSFFMCKNGRCIPSGGLCDNQDDCGDGSDERNCHINECLSKKVSGCSQDCQDLP
VSYKCKCWPGFQLKNDGKTCVDIDECSSGFPCSQQCINTYGTYKCLCIDGYEIQPDNLNG
CKSLSDEEPFLILADHHEIRKISTDGSNYTLLKQGLNNVIAIDFDYREEFIYWIDSNRPN
GSRINRMCLNGSDIKVVHNTAVPNALAVDWIGKNLYWSDTEKRIIEVSKLNGLYPTILVS
KKLKFPRDLSLDPQAGYLYWIDCCEYPHIGRVGMENQSVVIESKISRPMALTIDYVNHRL
YWADENHIEFSNMDGSHRHKVPNQDIPGVIALTLFEDYIYWTDGKTKSLSRAHKTSGADK
LSLINSWHAITDIQVYHSYRQPDVSKHICMINNGGCSHLCLLAPGKTHTCACPTNFYLAA
DNKTCLSNCTASQFRCKTDKCIPFWWKCDTVDDCGDGSDEPDDCPEFKCQGRFQCGTGLC
ALPAFICDGENDCGDNSDELNCDTHVCLSGQFKCTKNQKCIPVNLRCNGQDDCGDEEDER
DCPENSCSPDYFQCKTTKHCISKLWVCDEDPDCADASDEANCDKKTCGPHEFQCKNNNCI
PDHWRCDSQNDCSDNSDEENCKPQTCTLKDFLCANGDCVLXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSPTCSSSEYICASGGCIS
ASLKCNGEYDCSDGSDEMDCVSECKEDQFRCRNKAHCIPIRWLCDGIHDCVDGSDEENCD
RXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKFLCPPTRPHRCRNNRI
CLQPEQMCNGIDDCGDNSDEDHCGGKLTYKARPCKKDEFACTNKKCIPVDLQCDQLDDCG
DGSDEQGCRITPTEFTCEDNVNPCGDDAYCNQIKTSVFCRCKPGFQRNMKNRQCEXXXXX
XXXXTCSHQCINMEGSYKCVCDQNFQEKNNTCIAKGSEDQVLYIANDTDILGFIYPFNYS
GDHQQISHIEHNSRITGMDVYYQRDMIIWSTQFNPGGIFYKRVQGREKRQANSGLICPEF
KRPRDIAVDWVAGNIYWTDHSRMHWFSYYTTHWTNLRYSINVGQLNGPNCTRLLTNMAGE
PYAIAVNPKRGMMYWTVVGDHSHIEEAAMDGTLRRILVQKNLRRPTGLAVDHFSERIYWA
DLELSLIGSVLYDGSDSVISVSSRQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXPNPCLDLTCEFLCLLNPSGATCVCPEGKYLINGTCN
DDSLLDDSCKLTCENGGRCILNEKGDLRCHCWPSYSGERCQVNHCSNYCQNGGSCIPSAL
GRPTCSCALGFTGPNCGKTVCEDFCQNGGTCSVTAGNQPYCYCQPEHTGDRCQYYVCHHY
CVNSESCTIGDDGSVECVCPTRYEGPKCEVDKCIRCHGGHCIINKDSDDIFCNCTNGKIA
SSCQLCDGYCYNGGTCQLDPETNVPMCLCSTNWSGTQCERPAPKSSKSDHISTRSIAIIV
PLVLLVTLIATLVIGLVLCKRKRRTKTIRRQPIINGGINVEIGNPSYNMYEVDHDHSDGG
LLDPGFMIDPAKARYIGGGSSAFKLPHTAPPIYLNSDLKGPLTAGPTNYSNPVYAKLYMD
GQNCRNSLGSVDERKELLPKKIEIGIRETVA
Download sequence
Identical sequences ENSPVAP00000014333 ENSPVAP00000014333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]