SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000014744 from Pteropus vampyrus 76_1

(show help)
Strong hits

Sequence:	ENSPVAP00000014744
Domain Number 1	Region: 168-239
Classification Level	Classification	E-value
Superfamily	Homeodomain-like	7.27e-21
Family	Homeodomain	0.0014
Further Details:

Domain Number 2	Region: 30-95
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.00000000000000261
Family	LIM domain	0.009
Further Details:

Domain Number 3	Region: 2-29
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.0000000202
Family	LIM domain	0.022
Further Details:

Weak hits

Sequence:	ENSPVAP00000014744
Domain Number -	Region: 91-120
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.0161
Family	LIM domain	0.039
Further Details:

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Biological Process	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

External link(s)	Protein: ENSPVAP00000014744 Gene: ENSPVAG00000015637 Transcript: ENSPVAT00000015637
Sequence length	280
Comment	pep:known_by_projection genescaffold:pteVam1:GeneScaffold_1491:160277:164723:1 gene:ENSPVAG00000015637 transcript:ENSPVAT00000015637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MVHCAGCKRPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGKLYCKNDFFRCFG TKCAGCAQGISPSDLVRRARSKVFHLNCFTCMMCNKQLSTGEELYIIDENKFVCKEDYLS NSSVAKENSLHSATTGSDPSLSPDSQDPSQDDAKDSESANVSDKEGGSNENDDQNLGAKR RGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQ LSALGARRHAFFRSPRRMRPLVDRLEPGELIPNGPFSFYG
Download sequence
Identical sequences	ENSPVAP00000014744 ENSPVAP00000014744

SEARCH