SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000015098 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000015098
Domain Number 1 Region: 50-139
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.51e-33
Family SCAN domain 0.00012
Further Details:      
 
Domain Number 2 Region: 222-283
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.4e-22
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 3 Region: 488-545
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.15e-22
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 4 Region: 756-807
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.84e-19
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 5 Region: 967-1019
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.22e-16
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 830-881
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000159
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 7 Region: 600-655
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000371
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 8 Region: 673-722
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000092
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 9 Region: 859-914
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000478
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 10 Region: 530-582
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000169
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Weak hits

Sequence:  ENSPVAP00000015098
Domain Number - Region: 439-489
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000851
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000015098   Gene: ENSPVAG00000015998   Transcript: ENSPVAT00000015997
Sequence length 1022
Comment pep:novel scaffold:pteVam1:scaffold_16689:7168:14452:-1 gene:ENSPVAG00000015998 transcript:ENSPVAT00000015997 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPGRWHAVHPAQAQASRERGRLQMVKKEEEDEGYTSVQAARPQTLNRPGQELFRQLFRQ
LRYHESSGPLETLSRLQELCRWWLRPDVLSKAQILELLVLEQFLSILPGELRAWVQLHHP
ESGGEAAALLEELQRDVSGTPWRDPAPAQSPDVHWMGTDALRAAQIWPSASPPGSGSALG
DHLEPPNEIGVRDFLAGRSEPPAAQVPAPSQREGCPGDQVTAQPQEAITFKDVEVTFSQD
EWGWLNPAQRNLYRDVMLENYGNLASLVGPFTKPALISWLEAREPWGLNVQGPQPKGNPG
APPAGGELPIKTNKFLLKHEPLEEAETLAVPSGCHVMSVSEETGLREPLEQKSRLKERCG
NPAQVSVKKEETSFSHRAGKESEEPGGGNSLNLKHVTFLRVPRRKRSLKHGCGRHFRGGS
YHYDYKEYGKGLRRMIGGFSLHQRLHAGLKGAAKDTHGKDLSLGSLYQHGWSLHTVGTSY
KCSDCGKTFSNSSHLAYHQRLHTQEKPFKCRVCGKAFRWSSNRARHEKIHTGLKPYKCGI
CDKAFQRMFAYHLHQETHADQKVLESNQCEDALTDRSGFDHHLGDQSGEKLFDCSQCRKS
FHCKSYVLQHQRIHTQEKPYKCTKCRKTFRWRSNFSRHMRMHEEEKFYHQDKCGEDSGET
CGGSQPQSAPPAEKAFLCQQCGKTFTGKKSLINHQRVHTGKKLYRCSECAKEFSHRSAFV
VHKQQHSLRRKAEGGPSCSRDRVFQVPQSGHATEEPFTCGQCGKAFRNHSFLLIHQRVHT
REKPYMCRECGKAFRWSSNLSRHQRSHSLEKQYEHCESRSGAGQPPQILTGEKPFWCQEC
GKSFTRKRSLLDHKGIHSGEKRYKCNLCEKSYDRNYRLVNHQRIHTKERPFKCQWCGKDF
IGRHTLCIHQRKHSRAAQSESSPAGSSSSQDAGVRLQELKPRGEKPHEDCEQSSRLSRFQ
NIPVEKKCHRCSICGKAFSKTSQLISHKRFHTRERPFKCTECGKTFRWSSNLARHMKKHL
SD
Download sequence
Identical sequences ENSPVAP00000015098 ENSPVAP00000015098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]