SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000015228 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000015228
Domain Number 1 Region: 300-488
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.92e-49
Family Voltage-gated potassium channels 0.0011
Further Details:      
 
Domain Number 2 Region: 95-199
Classification Level Classification E-value
Superfamily POZ domain 3.92e-23
Family Tetramerization domain of potassium channels 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000015228   Gene: ENSPVAG00000016134   Transcript: ENSPVAT00000016134
Sequence length 536
Comment pep:known_by_projection scaffold:pteVam1:scaffold_548:120823:131527:1 gene:ENSPVAG00000016134 transcript:ENSPVAT00000016134 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKQSERRRSWSYKPWNITECENSQHRRSICSLGARSGSQASIPPWTGVSFNYYIEEDED
GEEQEWKDDLAKDDLAEEANTAQSDGHTTFPAVSSTLNVNVGGQSYRLDYTELACYPKTR
LGRLATSTSRSRQLGLCDDYEAQTDEYFFDRDPAVFQLVYNFYLSGVLLVLDELCPRSFL
EELGYWGVRLKYTPRCCRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSIVALALNTVEEMQQQSEQGGTRPIEHVML
CIAFFTLEYLLRLASTPDLRRFARSALNVDLVAILPLYLQLLLECFTDEDQRRSKAGSTV
GKVGQVLRIMRLMRIFRILKLARHSTGLRAFGFTLRQCYQQVGCLMLFITMGILTFSAAV
HSVEHDMPGTNFTSIPHAWWWAAVSISTVGYGDMYPETHLGRLFAFLCIAFGIILNGMPI
SILYNKFSDYYSKLKAYEYTAIRRERGKVEFMQRARKKVAECLARSNLQPAPRQEN
Download sequence
Identical sequences ENSPVAP00000015228 ENSPVAP00000015228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]