SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000015821 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000015821
Domain Number 1 Region: 171-478
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.08e-98
Family Protein kinases, catalytic subunit 0.0000000000838
Further Details:      
 
Domain Number 2 Region: 28-139
Classification Level Classification E-value
Superfamily PH domain-like 4.72e-22
Family Pleckstrin-homology domain (PH domain) 0.00000276
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000015821   Gene: ENSPVAG00000016770   Transcript: ENSPVAT00000016770
Sequence length 506
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_1956:362846:608447:-1 gene:ENSPVAG00000016770 transcript:ENSPVAT00000016770 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAAAENPNPKAGITEYHISKLGARGATMSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDG
SFIGYKEKPQDVDLPYPLNNFSVAKCQLMKTERPKPNTFIIRCLQWTTVIERTFHVDTPE
EREEWTEAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKL
LGKGTFGKVILVREKASGKYYAMKILKKEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKY
SFQTKDRLCFVMEYVNGGELFFHLSRERVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLK
LENLMLDKDGHIKITDFGLCKEGITDAATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLG
VVMYEMMCGRLPFYNQDHEKLFELILMEDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGP
DDAKEIMRHSFFSGVNWQDVYDKKLVPPFKPQVTSETDTRYFDEEFTAQTITITPPEKYD
EDGMDCVDSERRPHFPQFSYSASGRE
Download sequence
Identical sequences ENSPVAP00000015821 ENSPVAP00000015821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]