SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000016089 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000016089
Domain Number 1 Region: 21-48,93-166
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.57e-21
Family Voltage-gated potassium channels 0.0065
Further Details:      
 
Domain Number 2 Region: 196-311
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.88e-19
Family Voltage-gated potassium channels 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000016089   Gene: ENSPVAG00000017057   Transcript: ENSPVAT00000017057
Sequence length 410
Comment pep:known_by_projection scaffold:pteVam1:scaffold_2483:80478:157612:1 gene:ENSPVAG00000017057 transcript:ENSPVAT00000017057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGRGCGCSCGSGHLNEDNARFLLLAALIVLYLLGGAAVFSALELAHELQAKQRWEERLA
TFSRRHNLSRDELRDFLRHYEEATEAGIRVDNARQRWDFTGAFYFVGTVVSTIGFGMTTP
ATVGGKIFLIFYGLIGCASTILFFNLFLERLITVIAYIMKSCHQRQLRSRRALPQESLKN
AGKGEVDSLAGWKPSVYYVMLILCMASLLISCCASAMYTSVEGWSYFDSLYFCFVAFSTI
GFGDLVSSQNAQYDSQGLYRFANFVFILMGVCCIYSLFNVISILIKQSVNWILRKMDGGC
RQQCQSGLSRSRRNVIMPGHVQNRCNISIETDGVMESDTDGRRPSGEMISMKDFLAANKV
SLAVLQKQLSETANGCPHQASTLSRDNEFSGGVGAFAIMNNRLAETSGDR
Download sequence
Identical sequences XP_011355435.1.92234 ENSPVAP00000016089 ENSPVAP00000016089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]