SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000016162 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000016162
Domain Number 1 Region: 129-155,184-421
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.07e-68
Family Nuclear receptor ligand-binding domain 0.00000000182
Further Details:      
 
Domain Number 2 Region: 76-161
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.16e-30
Family Nuclear receptor 0.00000936
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000016162   Gene: ENSPVAG00000017132   Transcript: ENSPVAT00000017131
Sequence length 423
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_325:321275:326251:1 gene:ENSPVAG00000017132 transcript:ENSPVAT00000017131 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSQVVGIEPLYIKAEPASPDSPKGSSETETEPSVALAPGPAPTRHLPGHKEEEDGEGAG
PGEQGGGKLVLSSLPKRLCLVCGDVASGYHYGVASCEACKAFFKRTIQGSIEYSCPASNE
CEITKRRRKACQACRFTKCLRVGMLKEGVRLDRVRGGRQKYKRRPEVDPLPFPGPFSAGP
LAVAGGPRKTAAPVNALVSHLLVVEPEKLYAMPDPAGPDGHLPAVATLCDLFDREIVVTI
SWAKSIPGFSSLSLSDQMSVLQSVWMEVLVLGVAQRSLPLQDELAFAEDLVLDEEGARAA
GLGELGAALLQLVRRLQALRLEREEYVLLKALALANSDSVHIEDAEAVEQLREALHEALL
EYEAGRAGPGGGAERRRAGRLLLTLPLLRQTAGKVLAHFYGVKLEGKVPMHKLFLEMLEA
MMD
Download sequence
Identical sequences ENSPVAP00000016162 ENSPVAP00000016162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]