SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000016296 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000016296
Domain Number 1 Region: 38-483
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 3.79e-87
Family Integrin alpha N-terminal domain 0.00000000118
Further Details:      
 
Domain Number 2 Region: 784-1014
Classification Level Classification E-value
Superfamily Integrin domains 6.8e-63
Family Integrin domains 0.0000057
Further Details:      
 
Domain Number 3 Region: 484-642
Classification Level Classification E-value
Superfamily Integrin domains 6.28e-46
Family Integrin domains 0.0000165
Further Details:      
 
Domain Number 4 Region: 643-776
Classification Level Classification E-value
Superfamily Integrin domains 3.14e-36
Family Integrin domains 0.0000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000016296   Gene: ENSPVAG00000017272   Transcript: ENSPVAT00000017273
Sequence length 1062
Comment pep:known_by_projection scaffold:pteVam1:scaffold_1412:25230:164895:1 gene:ENSPVAG00000017272 transcript:ENSPVAT00000017273 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTGARRGLRVSPGQPLAPFCCLSAALGMLWSPASQAFNLDVDQLTVYSGPEGSYFGYAV
DFHIPAAHTASVLVGAPRANTSQPDIVEGGAVYYCPWPAEGSAQCKQIPFDNTNNRKIRV
NGTKEPIEFKSNQWFGAAVRAHGGRVVACAPLYHWRTLKSTPEKDPVGTCYVAIQNFSAY
AEYSPCRNSNADPEGQGYCQAGFSLDFYKNGDLIVGGPGSFYWQGQVITASIADIIANYS
FKDILRKLAREKQTDVAPASYDDSYLXXXXXXXXXXXDFQQKLVAGVPRGAQNFGYVSII
NSTDMTFIQNFTGEQMASYFGYAVAVSDVNSDGLDDILIGAPLFMEREFESNPREIGQVY
LYMQVSAFVFGDPQVLAGTEVFGRFGSAVAHLGDLNQDGYNDIAIGAPFAGQDQRGKVLV
YNGNKHGLNTEPSQILQGVWASRGVPSGFGFTLRGDSDIDKNDYPDLIVGAFGTGKVAVY
RARPVVTVDAQLLLNPMIINLENKTCQIPESTTPVACFSLRVCASVAGQSISDTIGLTAE
VELDSLKQKGAVKRTLFLDNRQSRLVFPLATKRQGSRQCRDFTVYLRDETEFRDKLSPIN
ISLNYSLDESTLKEGLEVKPILNHYRENVVTEQAHILVECGEDNMCIPDLKLSARPDKHQ
VIVGDENHLMLIINARNEGEGAYEAELFVIIPEEADYVGIERGNKGFRSLSCEYKMENVT
RTVVCDLGNPMVAGTNYSLGLRFTVPRLEKTNMSINFDLQIRSSNKDNPDSNLVSLQINI
TAVAQVEIRGVSHPLQIVLPIHNWAPEEEPRKEEGVGPLVEHIYELHNIGPSAISDTLLE
VGWPFFARDEFLLYIFHIQTLGPLQCQTNPDINPQDIKPAAPPVDTPELSAFLRNSTIPH
LIRKRDVPVLEPHRQSPMKILNCTNIECLRISCVVGRLEGGESAVLKVRSRLWAKTFLQR
KNDPYSLASLVSFEVKKMPYKDQPEKLPEGSIAIKTSVIWATPNVSFSIPLWVIILAILL
GLLVLAILTLALWKCGFFDRARPPQDDTNDREQLTDEKTPGA
Download sequence
Identical sequences ENSPVAP00000016296 ENSPVAP00000016296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]