SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000016800 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000016800
Domain Number 1 Region: 80-360
Classification Level Classification E-value
Superfamily L domain-like 4.99e-53
Family Ngr ectodomain-like 0.0016
Further Details:      
 
Domain Number 2 Region: 417-496
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000921
Family Fibronectin type III 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSPVAP00000016800
Domain Number - Region: 33-78
Classification Level Classification E-value
Superfamily L domain-like 0.000238
Family Ngr ectodomain-like 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000016800   Gene: ENSPVAG00000017810   Transcript: ENSPVAT00000017810
Sequence length 660
Comment pep:known_by_projection scaffold:pteVam1:scaffold_1480:125391:127373:1 gene:ENSPVAG00000017810 transcript:ENSPVAT00000017810 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLQTTQWPSHGAFFLKSWLVISLGLYSQVSKILACPSVCRCDRIFVYCNERSLTSVPLG
IPEGVTVLYLHNNQINNAGFPAELHNVQSVHTVYLYGNQLDEFPMNLPKNVRVLHLQENN
IQTISRAALAQLLKLEELHLDDNSISTVGVEDGAFREAVSLKLLFLSKNHLSSVPVGLPV
DLQELRVDENRIAVISDMAFQNLTSLERLIVDGNLLTNKGIAEGTFSHLTKLKEFSIVRN
SLSHPPPDLPGTHLIRLYLQDNQINHIPLTAFANLRKLERLDISNNQLRMLTQGVFDNLS
NLKQLTARNNPWFCDCSIKWVTEWLKYIPSSLNVRGFMCQGPEQVRGMAVRELNMNLLSC
PTTTPGLPLFTPAPRTAFPTTQPPTASVPIPSRSYTPPTPTTSRLPTIPDWDGRERVTPP
ISERIQLSVHFVNDTSIQVGWLSLFTVMAYKLTWVKMGHSLVGGIVQERIVSGEKQHLSL
VNLEPRSTYRICLVPLDAFNYRAVEDTICSEATTHASYLNNGSNTASSHEQTTSHSMGSP
FLLAGLIGGAVIFVLLVLLSVFCWHMHKKGRYTSQKWKYNRGRRKDDYCEAGTKKDNSIL
EMTETSFQIVSLNNDQLLKGDFRLQPIYTPNGGINYTDCHIPNNMRYCNSSVPDLEHCHT
Download sequence
Identical sequences ENSPVAP00000016800 XP_011355416.1.92234 XP_011355417.1.92234 XP_011355418.1.92234 XP_011355419.1.92234 XP_011355420.1.92234 ENSPVAP00000016800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]