SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000017073 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000017073
Domain Number 1 Region: 174-456
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.02e-77
Family Nuclear receptor ligand-binding domain 0.00000000172
Further Details:      
 
Domain Number 2 Region: 124-201
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.46e-25
Family Nuclear receptor 0.0000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000017073   Gene: ENSPVAG00000008613   Transcript: ENSPVAT00000024168
Sequence length 457
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_3722:14613:213024:-1 gene:ENSPVAG00000008613 transcript:ENSPVAT00000024168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPVELCLPSFXXXXXXXLLCRMSNKDRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGS
SDASGSYSSTMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYMLN
SMPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQ
ACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRIDAENSPYLNPQLVQPAKKPYNKIVSHL
LVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLL
QSAWMEILILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKL
EKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHVEDPRRAGKMLMTL
PLLRQTSTKAVQHFYSIKLEGKVPMHKLFLEMLEAKV
Download sequence
Identical sequences ENSPVAP00000017073 ENSPVAP00000017073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]