SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01000425001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01000425001
Domain Number 1 Region: 697-958
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.32e-67
Family Protein kinases, catalytic subunit 0.00012
Further Details:      
 
Domain Number 2 Region: 144-245
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.2e-22
Family alpha-D-mannose-specific plant lectins 0.0049
Further Details:      
 
Weak hits

Sequence:  GSVIVT01000425001
Domain Number - Region: 401-467
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00785
Family Hairpin loop containing domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01000425001
Sequence length 1004
Sequence
MFELVDPINEIGHFFCELGTTPDMVVDRKHWGLIQQQPLPQLQVKKGSLNYLMVINRRRI
AITWSTTIHMVSTIFILYPILLCCYQTCAARDTIRQNDPISDGDGETLLSAGKTFELGFF
TPNGSSSHQRYVGIWYYRLEPKTVVWVANRNDPLPDSTGVLSIQDGNLVLNSNGRGRPFW
STPLQKSSSTEKVAQLIDSGNLVLKNDQLQTSLWQSFGNATDTFLPGMKMDGNLVLTSWK
SSSDPGSGNFTFRKDQVAQNLYIIQNGPNTYWKSGISDDFITSGWDHKMYSELSKMLSNS
SINSSQPTTSFYYRRLVMKFSGQIEYLQFRNQTGSWYSLLKEPKNSCDGNNPCGSFASCS
TRNRILCRCLPGFQPNFPAKWNGGDFSGGCRRISPLCSKNDTFLRLEMMRVKKSDTQFNT
TNEKECENYCNRDCNNCQAYAYVEAETRADTAICMIWEENLNDIQEAYLDGGHDLYVRVA
VSDIEPMGRNCKICGTNIIPYPLSTGTDCGDPKYLSFYCENSTGQVIFMRPNNTYYQVTS
IRPEAKEFSIQLGEDNCIASSDAMKKLLEFNQDSPFLVKSGCTAEKSTSSLYPFSDAEWL
REIQIEWRPPLEPICNSTEDCKYWAHSNCNTTGDGQKRCHCKINYQWDPTNVSCFPVEHR
GSIQGNPVLHLYHSERRVKDLIGWGQFTEDDREGIDVPFFDLGSILAATNNLSDANKLGQ
GGFGPVYKGSFPGGQDIAVKRLSSVSGQGLEEFKNEVVLIAKLQHRNLVRLLGYYRTLRF
LLNWEKRFDIILGIARGLLYLHQDSRLRIIHRDLKTSNILLDEEMNPKISDFGLARIFGG
KQTEASTNRVVGTYGYMSPEYALDGFFSIKSDVFSFGVVVLEIISGKRNTGFYQSQQALS
LLGYAWRLWQENKALDLMDQSLHETCDVAEFLRCVNVGLLCVQEDPSDRPVMSNVVFLLG
SETATLPTPKQPAFTVRRGVFSTASSSSKPETCTNELTVSVDGR
Download sequence
Identical sequences GSVIVT01000425001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]