SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01002472001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01002472001
Domain Number 1 Region: 103-385
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.99e-77
Family Protein kinases, catalytic subunit 0.00012
Further Details:      
 
Domain Number 2 Region: 574-675
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.69e-27
Family Protein kinases, catalytic subunit 0.0024
Further Details:      
 
Weak hits

Sequence:  GSVIVT01002472001
Domain Number - Region: 447-489
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00902
Family Pan module (APPLE domain) 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01002472001
Sequence length 676
Sequence
MLWSGSLIDLQKFTKRGADLYIRLAHSELDKKRDMKVIISVTIVIGTIAIAICTYFLWRW
IGRQAVKEKSKEILPSDRGDAYQNYDMNMLGDNVNRVKLEELPLLDFEKLAAATNNFHEA
NKLGQGGFGPVYRGNLPGGQEIAVKRLSRASAQGQEEFMNEMILISKIQHRNLVRLLGFC
IEGDEKLLIYEYMPNKSLDAFLFDPLKRESLDWRRRFSIIEGIGRGLLYPHRDSRLKIIH
RDLKASNILLDEDLNAKISDFGMARIFGSNQDQANTMRVVGTYGYMSPEYAMGGQFSEKS
DVFSFGVLLLEIAWTLWSEHNIQELIDETIAEACFLEEISRCIHVGLLCVQESAKERPSI
STVLSMLSSEIAHLPSPKQPPFLENCLRGYEPKYIEEWSRGNWTSGCVRKTPLQCERTNS
SGQQGKLDGFFRLTTVKVPDFADWSLALEDECREQCLKNCSCMAYSYYSGIGCMSWSGNL
IDLQKFTQGGADLYIRLANSELDKKKDMKAIISVTIVIGTIAIGICTYFSWRWRRKQTMK
DKSKEILLSDRGDAYQIYDMNRLGDNANQVKLEELPLLALEKLATATNNFHEANKLGQGG
FGPVYRGKLPGGQEIAVKRLSRASAQGLEEFMNEVMVISKIQHRNLVRLLGCCIEGDEKL
LIYEYMPNKSLDAFLF
Download sequence
Identical sequences GSVIVT01002472001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]