SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01002515001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01002515001
Domain Number 1 Region: 238-323
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.14e-20
Family Protein kinases, catalytic subunit 0.0027
Further Details:      
 
Weak hits

Sequence:  GSVIVT01002515001
Domain Number - Region: 37-79
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000216
Family alpha-D-mannose-specific plant lectins 0.01
Further Details:      
 
Domain Number - Region: 114-159
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00377
Family Anti-platelet protein 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01002515001
Sequence length 324
Sequence
MKVELVNDTGNTYALWMELLPMKISTNTHTGEKVVLTSWKSPSDPSIGSFSAGINPLNIP
QVFVWNGSHPYWRSGPWNGQIFIGVPEMNSGKIDGFFRLTSVKVPDFADWSLALEDECRK
QCFKNCSCVAYSYYSSIGCMSWSGNMIDSQKFTQGGADLYIRLAYSELDKKRDMKAIISV
TIVIGTIAFGICTYFSWRWRGKQTVKDKSKGILLSDRGDVYQIYDKNMLGDHANQVKFEE
LPLLALEKLATATNNFHEANMLGQGGFGPVYRGKLPGGQEIAVKRLSRASAQGLEEFMNE
VMVISKIQHRNLVRLLGCCIEGDE
Download sequence
Identical sequences GSVIVT01002515001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]