SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01005707001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01005707001
Domain Number 1 Region: 198-240
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000245
Family Protein kinases, catalytic subunit 0.016
Further Details:      
 
Weak hits

Sequence:  GSVIVT01005707001
Domain Number - Region: 51-107
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000902
Family Anti-platelet protein 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01005707001
Sequence length 263
Sequence
MCGPYGICKLVDQTICECPFGFTPKSPQDWNARQTSAGCVARKPLNCRAGEGFRKFKGLK
LPDASYLNRTVASPAECEKACLSNCSCVAYANTDVSACVVWFGDLKDIRRYNEGGQVLHI
RMAASELGKCLPWITQSYHYKTTVKSQYSIVSVFSYMVRLQEQENPGVSSDDGNFISSSV
GFSGELVYNPNQSFSRDIGEEDLELPLFDLVTIKVATNNFSLANKIGQGGFGLVYKVISY
HIFTGNCSMERKKWAYWLISTII
Download sequence
Identical sequences GSVIVT01005707001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]