SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01005714001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01005714001
Domain Number 1 Region: 869-1177
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.34e-83
Family Protein kinases, catalytic subunit 0.0000924
Further Details:      
 
Domain Number 2 Region: 96-326
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.64e-75
Family Protein kinases, catalytic subunit 0.0000934
Further Details:      
 
Domain Number 3 Region: 484-590
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.4e-29
Family alpha-D-mannose-specific plant lectins 0.0042
Further Details:      
 
Weak hits

Sequence:  GSVIVT01005714001
Domain Number - Region: 693-727
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00239
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01005714001
Sequence length 1203
Sequence
MDTRVFTKGGQALFLRVDAVTLAQSKRKKNIFHKKWMIGILTMGVALVTVLMVSLSWLAT
KKRKGKGRQHKALFNLSLNDTWLAHYSKAKQVNESGTNSELQLFDLSTIVAATNNFSFTN
KLGRGGFGSVYKGQLSNGQEIAVKRLSKDSRQGVEEFKNEVTLIAKLQHRNLVKLLGCCI
EEEEKMLIYEYLPNKSLDSFIFDETKRSMLTWEKRFEIIIGIARGILYLHQDSRLRIIHR
DLKASNVLLDVDMIPKILDFGMARLFGGNQIEGSTNRVVGTYGYMSPEYAMEGLFSIKSD
VYSFGVLLLEIITRRRNTTYYCDSPFFNLVGYVSKLNLCCFIFPYIIYFYKLPNIERKNQ
VWSLWNEGKALDVVDVSLIKSNHANEGLRSIQIGLLYMWLRHGFFVRVLVFYFLILNFIL
FCILDLLYSCLLQMQPCKAFVICSTHGDLLVSKQSRFALGFFSPRNSTLRYIGVWYNTIR
EQTVVWVLNRDDPINDTSGVLSINTSGNLLLHRGNTHVWSTNVSISSVNPTVAQLLDTGN
LVLIHNGDKRVVWQGFDYPTDSWLPYMKLGLNRRTGFNRFLTSWKSPTDPGTGKYSLGFN
VSGSPQIFLYQGSEPLWRTGNWNGLRWSGLPVMKYIIQHKIIFLNNQDEISEMFTMANAS
FLERVTVDHDGYLQRNMWQEREDKWFSFYTAPRDRCDRYGLCGPNSNCDDSQAEFECTCL
AGFEPKSPRDWFLKDGSAGCLRKEGAKVCGNGEGFVKVGRAKPPDTSVARVNMNISMEAC
REECLKECSCSGYAAANVSGSGSGCLSWHGDLVDTRVFPEGGQDLYVRVDAITLGIGRQN
KMLYNSRPGATWLQDSLGAKEHDESTTNSELQFFDLNTIVAATNNFSFENELGRGGFGSV
YKGQLYNGQEIAVKKLSKDSGQGKEEFKNEVTLIAKLQHVNLVRLLGCCIQEEEKMLVYE
YLPNKSLDSFIFDETKRSLLDWRKRFEIIVGIARGILYLHEDSRLRIIHRDLKASNVLLD
AEMLPKISDFGLARIFGGNQMEGNTNRVVGTYGYMSPEYAMEGLFSTKSDVYSFGVLLLE
IITGRKNSTHYRDNPSMNLVGNVWNLWEEDKALDIIDSSLEKSYPTDEVLRCIQIGLLCV
QESAIDRPTMLTIIFMLGNNSALPFPKRPTFISKTTHKSQDLSSSGERLLSGNNVTLTLL
QPR
Download sequence
Identical sequences GSVIVT01005714001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]