SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01005720001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01005720001
Domain Number 1 Region: 211-262
Classification Level Classification E-value
Superfamily PapD-like 0.00000131
Family MSP-like 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01005720001
Sequence length 348
Sequence
MNSNFNLSWTNKVIVILKLSTTQNITLLLRSKPHHLRSTLFDPIPGVIQPWDACVIXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPDMQCKDKFLLQSTIVPPHTDLDELPQDAF
NKDSGKVIEECKLRVVYTLANRNSGDGSFASSNENADYNSNPTLQSLKEERDSAVRQTQQ
LQQELELLKRRRYPKSSGFSFRFALLVALIGIMVGFLLNLSLSSPSTE
Download sequence
Identical sequences E0CW13
GSVIVT01005720001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]