SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01006315001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01006315001
Domain Number 1 Region: 332-630
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.03e-66
Family Protein kinases, catalytic subunit 0.0002
Further Details:      
 
Weak hits

Sequence:  GSVIVT01006315001
Domain Number - Region: 17-59
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000288
Family alpha-D-mannose-specific plant lectins 0.01
Further Details:      
 
Domain Number - Region: 202-246
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.011
Family Anti-platelet protein 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01006315001
Sequence length 647
Sequence
MKLSTNTHIGEKKVVLTSWKSPSDPSIGSFSLGMNPLNIPQAFVWNGSHPYWRSGPWNGQ
IFIGQIYIGAGTVYETFTLANSSIFLYYVLTPQGTVVETYREDGKEEWEVTWRSNNSECD
VYGTCGAFGICNSGNSPICSCLRGYEPKYIEEWSRGNWTSGCVRKTPLQCERTNSSGQQG
KLDGFFRLTTVKVPDFADWSLALEDECREQCLKNCSCMAYSYYSGIGCMSWSGNLIDLGK
FTQGGADLYIRLANSELDKKRDMKAIISVTIVIGTIAIGIYTYFSWRWRRKQTVKDKSKE
ILLSDRGDAYQIYDMNRLGDNANQFKLEELPLLALEKLETATNNFHEANKLGQGGFGPVY
RGKLPGGQEIAVKRLSRASAQGLEEFGNEVVVISKIQHRNLVRLLGYCIEGDEKFNAAVF
LCTLPIEAYVSVFFFYVHHSDPLKRDFLDWRRRFNIIEGIGRGLLYLHRDSRFRIIHRDL
KASNILLDEDLTAKISDFGIARIVGGNQDQANTMRVVGTYGYMSPEYAMEGRFSEKSDVF
SFGVLLLEIAWTLWCEHNIEELIDEIIAEEGFQEEISRCIHVGLLAVQELAKDRPSISTV
VSMLSSEIAHLPPPKQPPFLEKQIESSQPRQNKYSSNQVTVTVIQGR
Download sequence
Identical sequences GSVIVT01006315001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]