SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01006316001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01006316001
Domain Number 1 Region: 253-548
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.23e-71
Family Protein kinases, catalytic subunit 0.00017
Further Details:      
 
Weak hits

Sequence:  GSVIVT01006316001
Domain Number - Region: 119-171
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000608
Family Pan module (APPLE domain) 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01006316001
Sequence length 568
Sequence
MNGQKVTVCGRLFGRAIKVSAMFMVHRNGWGVTWRSNKSECDVYGTCGAFGICNSGTSPI
CSCLRGYEPKYTEEWSRGNWTSGCVRKTTLQCERTNSSGQQGKIDGFFRLTTVKVPDYAD
WSLAHEDECREECLKNCSCIAYSYYSGIGCMLWSGSLIDLQKFTKRGADLYIRLAHSELD
KKRDMKVIISVTIVIGTIAIAICTYFLWRWIGRQAVKEKSKEILPSDRGHAYQNYDMNML
GDNVNRVKLEELPLLDFEKLAAATNNFHEANKLGQGGFGPVYRGNLPGGQKIAVKRLSRA
SAQGQEEFMNEMIVISKIQHRNLVRLLGFCIEGDQFFLSILSIDSYVSVFLFCAHNLDPL
KRESLDWRRRFSIIEGIGRGLLYLHRDSRLKIIHRDLKASNILLDEDLNAKISDFGMARI
FGSNQDQANTMRVVGTYGYMSPEYAMGGQFSEKSDVFSFGVLLLEIAWTLWCEHNIKELI
DETIAEACFQEEISRCIHVGLLCVQESAKDRPSISTVVSMLSSEIAHLPPPKQPPFLEKQ
TAIDIESSQLRQNKYSSNQVTVTVIQGR
Download sequence
Identical sequences GSVIVT01006316001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]