SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01006317001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01006317001
Domain Number 1 Region: 14-272
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-75
Family Protein kinases, catalytic subunit 0.0001
Further Details:      
 
Domain Number 2 Region: 483-675
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-62
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Weak hits

Sequence:  GSVIVT01006317001
Domain Number - Region: 291-333
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000678
Family alpha-D-mannose-specific plant lectins 0.01
Further Details:      
 
Domain Number - Region: 352-401
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0173
Family Pan module (APPLE domain) 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01006317001
Sequence length 677
Sequence
MLGNNVNQVKLEEQQLINIEKLVTATNNFHEANKLGQGGFGSVYRGKLPEGQEIAVKRLS
RASAQGLEEFLNEVMVISNVQHRNLVRLLGCCTEGDEKMLVYEYLPNKSLDAFLFDPVKR
DSLTWRRRFSIIEGIARGLLYLHRDSRFRIIHRDLKPSNILLDEDMNPKISDFGMARIFQ
AKQDKANTVRIAGTYGYMSPEYAMEGIFSEKSDVFSFGVLLLEIISGIKSAGFCHDEQSL
SLLGYAWKLWNGDSMEAFIDGRISEECYQEEILRCIHVGADTYSGEKVVLTSWKSPSDPS
IGSFSLGMSPLNIPQAFVWNGSHPYWRSGPWNGQIFIGVPKMNSVFLNGFQVVDDKEDEC
REQCLKNCSCMVYSYYSGIGCMSWSGNLIDLGKFTQGGADLYVRLANSELDKKRDMKAII
SVTIVIGIIAIGICTYFSWRWRRKQIVKDKSKEILLSDRGDAYQIYDMNRFGDHANQVKL
EELPLLALGKLATATNNFHEANKLGQGGFGPVYKGKLPGGQEIAVKRLSRASAQGLEEFM
NEVVVISKIQHRNLVRLFGYCIEGGEKLLIYEYMPNKSLDSFLFDPLKRDFLDWRRCFNI
IEGIGRGLLYLHRDSRLRIIHRDLKASNILLDEDLTAKISDFGIARIVGRYQDQANTMRV
VGTYGYMSPEYAMEGRF
Download sequence
Identical sequences GSVIVT01006317001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]