SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01006319001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01006319001
Domain Number 1 Region: 378-558
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.97e-46
Family Protein kinases, catalytic subunit 0.00086
Further Details:      
 
Domain Number 2 Region: 128-151
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000436
Family Retrovirus zinc finger-like domains 0.0023
Further Details:      
 
Weak hits

Sequence:  GSVIVT01006319001
Domain Number - Region: 258-303
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0275
Family Pan module (APPLE domain) 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01006319001
Sequence length 604
Sequence
MKKLFNLKMTENASVAQHLNEFNTITSVEIDFNDEIRALIVLASLPNSWETMRMAISNST
GKENLKYNYIRDLILAEEIRRRNVGETLGSGSVLNLETRGRGNDRNSNRGRSKPRNSNQN
ISKSRLDQQVQCWNCGKTCHFRRQCKSPKKKNEDDSANVVTEEVHDALLLAVDSPLDDWV
LDSQLCFIPLHTKKSYRIMLHVILVRCIWLMVQPWMLWVWETFGYCCPMGLFLGKIDGFF
RVTMVKVPDFVEWFPALKNQCRDMCLKNCSCIAYSYNNGIGCMSWSRDLLDMQKFSSSGA
DLYIRVADTELDKKGNVKVIVSVVVIIGTITIICIYLSCRCWMTKQRGNISHLTYSTSIV
SYLLFSVLDASNSAPVKRDSLTWRRRFSIIEGIARGLLYLHRDSRLRIIHRDLKPSNILL
DEDMNPKISDFGMARIFQAKQDKANTVRIAGTYGYMSPEYAMEGIFSEKSDVFSFGVLLL
EIISGIKSAGFCHDEQSLSLLGYAWKLWNGDSMEAFIDGRISEECYQEEILRCMHVGLLC
VQELAKDRPSISIVVSMLCSEIAHLPSSKPPAYSERQIIIDTEFSRRQNLCSVNQVTVTN
VHAR
Download sequence
Identical sequences GSVIVT01006319001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]