SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01006351001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01006351001
Domain Number 1 Region: 485-772
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.59e-79
Family Protein kinases, catalytic subunit 0.0001
Further Details:      
 
Domain Number 2 Region: 74-180
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 6.15e-26
Family alpha-D-mannose-specific plant lectins 0.0024
Further Details:      
 
Weak hits

Sequence:  GSVIVT01006351001
Domain Number - Region: 350-408
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00706
Family Anti-platelet protein 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01006351001
Sequence length 817
Sequence
MRRPSKKAVSLLLTCFWFVFGCSAIDTITSTHFIKDPETIVSSGRVFKLGFFSLDGSSNR
YVGIWYNTTSLLTIIWVANKDRPLNDSSGVLTISEDGNIQVLNGRKEILWSSNVSNPAAV
NSSAQLQDSGNLVLRDKNGVSVWESLQNPSHSFVPQMKISTNTRTRVRKVLTSWKSSSDP
SMGSFTAGVEPLNIPQVFIWNGSRPYWRSGPWDGQILTGVDVKWITLDGLNIVDDKEGTV
YVTFAHPESGFFYAYVLTPEGILVETSRDKRNEDWERVWTTKENECEIYGKCGPFGHCNS
RDSPICSCLKGYEPKHTQEWNRGNWTGGCVRKTPLQCERTKNGSEEAKVDGFLKLTNMKV
PDFAEQSYALEDDCRQQCLRNCSCIAYSYYTGIGCMWWSGDLIDIQKLSSTGANLFIRVA
HSELKQDRKRDARVIVIVTVIIGTIAIALCTYFLRRWIARQRGNLLIGKFSDPSVPGDGV
NQVKLEELPLIDFNKLATATNNFHEANKLGQGGFGPVYRGKLAEGQDIAVKRLSRASTQG
LEEFMNEVVVISKLQHRNLVRLIGCCIEGDEKMLIYEFMPNKSLDASLFDPVKRQILDWR
TRFKIIEGIGRGLLYLHRDSRLRIIHRDLKASNILLDEDLNPKISDFGMARIFGSNQDQA
NTKRVVGTYGYMSPEYAMEGRFSEKSDVFSFGVLLLEIVSGRKNSSFYHEEYFTLLGYAW
KLWKEDNMKTLIDGSILEACFQEEILRCIHVGLLCVQELAKDRPSVSTVVGMICSEIAHL
PPPKQPAFTEMRSGIDIESSDKKCSLNKVSITMIEGR
Download sequence
Identical sequences D7T5C7
GSVIVT01006351001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]