SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01006353001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01006353001
Domain Number 1 Region: 283-571
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.51e-80
Family Protein kinases, catalytic subunit 0.00015
Further Details:      
 
Weak hits

Sequence:  GSVIVT01006353001
Domain Number - Region: 119-193
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0589
Family Pan module (APPLE domain) 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01006353001
Sequence length 619
Sequence
MKSSSVFTFDFEWNQDGAYYSYELTNKSITSRLMVSSAGSLQRYTWIETRQVWNLYWFAP
KDQCDDYRECGPYGICDTNSSPVCKCPRGFEPKNPQAWNLRDGSDGCSRKTEFDCNNGDG
FLALKRMKLPETGSSFVDKSMSLKDCEMTCRKNCSCTGYANPEITSDKGCIIWTTDLLDM
REYAEGEGGQDLYIRVAASELGSENGSNKTVKIIKVTCITVGSAVLLLGLGICYLWKRKK
MKIMWNGKTRQRGLSERSHDYILNEAVIPSKRDYTDEVKTDELELPLFDFGTIVLATNNF
SDTNKLGQGGFGCVYKGMLLEGEEIAVKRLAKNSGQGIEEFMNEVRLIARLQHRNLVQLL
GCCVEMEEKMLIYEYMQNRSLDSILFDEKKSSLLDWGRRFNIICGVARGLLYLHQDSRFR
IIHRDLKASNVLLDGEMNPKISDFGMARIFGRDQTEANTKRVVGTYGYMSPEYAMDGLFS
VKSDVFSFGVLVLEIISGKKNRGFYHLNDEHNLLGHAWRLWREGKGLELMDSSVSESCAP
YDVLRCIQVGLLCVQEHAEDRPVMSSVVLMLSSETATLPLPKNPGFCLGRKLVETDSSSS
KQEETFTVNQVTVTVMDAR
Download sequence
Identical sequences GSVIVT01006353001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]