SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01006478001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01006478001
Domain Number 1 Region: 350-599
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.43e-76
Family Protein kinases, catalytic subunit 0.0000812
Further Details:      
 
Domain Number 2 Region: 1042-1229
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.24e-55
Family Protein kinases, catalytic subunit 0.00025
Further Details:      
 
Domain Number 3 Region: 662-768
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.14e-29
Family alpha-D-mannose-specific plant lectins 0.005
Further Details:      
 
Weak hits

Sequence:  GSVIVT01006478001
Domain Number - Region: 127-160
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000727
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 871-904
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000867
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 16-58
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00128
Family alpha-D-mannose-specific plant lectins 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01006478001
Sequence length 1229
Sequence
MKLGLDRRTGFNRFLTSWKSPTDPGTGKNSLTINASGSPQFFLYQGSKPLWRSGNWNGFR
WSGVPTMMHGTIVNVSFLNNQDEISYMYSLINVWLPTTLTIDVDGYIQRNSWLETEGKWI
NSWTVPTDRCDRYGRCGVNGNCDNSRAEFECTCLAGFEPKSPRDWSLKDGSAGCLRKEGA
KVCGNGEGFVKVEGAKPPDTSVARVNTNMSLEACREGCLKECSCSGYAAANVSGSGSGCL
SWHGDLVDTRVFPEGGQDLYVRVDAITLGFLAKKGMMAVLVVGATVIMVLLVSTFWFLRK
KMKGNQTKILMVHLSLLSNVWRGRQNKMLYNSRLGATWLQDSPGAKEHDESTTNSELQFF
DLNTIAAATNNFSSENELGRGGFGSVYKGQLSNGQEIAVKKLSKDSGQGKEEFKNEATLI
AKLQHVNLVRLLGCCITEEEKMLVYEYLPNKSLDSFIFDETKKSLLDWRKRFEIIVGIAR
GILYLHEDSRLRIIHRDLKASNVLLDAEMFPKISDFGLARIFRGNQMEGNTNRVVGTYGY
MSPEYAMEGLFSTKSDVYSFGVLLLEIITGRKNSTYYQDNPSMSLIGNSHMHPVKMFLQY
LILFLMLPLCSSTDTITPNQPFRDGDLLVSKESRFALGFFSPRNSTLRYIGVWYNTIREQ
TVVWVLNRDHPINDTSGVLSINTSGNLLLHRGNTHVWSTDVSISSVNPTVAQLLDTGNLV
LIQKDDKMVVWQGFDYPTDNLIPHMKLGLNRRTGYNRFLTSWKSPTDPATGKYSLGFNVS
GSPQIFLYQGSEPLWRSGHWNGLRWSGLPVMMYRFQHKVSFLNNQDEIYYMFIMVNASFL
ERLTVDHEGYIQRNMWQETEGKWFSFYTAPRDRCDRYGRCGPNSNCDNSQAEFECTCLAG
FEPKSPRDLFLKDGSAGCLRKEGAKVCGNGEGFVKVGGAKPPDTSVARVNMNISMEACRE
ECLKECSCSGYAAANVSGSGSGCLSWHGDLVDTRVFPEGGQNLYVRVDAITLGIGRQNKM
LYNSRPGATWLQDSPGAKEHDESTTNSELQFFDLNTIVAATNNFSSENELGRGGFGSVFK
GQLSNGQEIAVKKLSKDSGQGKEEFKNEATLIAKLQHVNLVRLVGCCITEEENMLVYEYL
SNKSLDSFIFDETKKSLLDWRKRFEIIVGIARGILYLHEDSRLRIIHRDLKASNVLLDAE
MFPKISDFGLARIFRGNQMEGNTNRVVGT
Download sequence
Identical sequences GSVIVT01006478001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]