SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01006784001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01006784001
Domain Number 1 Region: 361-464
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.02e-26
Family Protein kinases, catalytic subunit 0.0028
Further Details:      
 
Weak hits

Sequence:  GSVIVT01006784001
Domain Number - Region: 68-110
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000155
Family alpha-D-mannose-specific plant lectins 0.01
Further Details:      
 
Domain Number - Region: 247-303
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0051
Family Anti-platelet protein 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01006784001
Sequence length 466
Sequence
MLLRFSHLGIRRNLHRRCNLLMRLGPMEGFRLIRDTIFSRLRGGLSRCFLPLCCCCTNTR
TGVRKVLTSWKSSSDPSMGSFTAGVEPLNIPQVFIWNGSRPYWRSGPWDGQILTGVDVKW
ITLDGLNIVDDKEGTVYITFAYPDSGFFYAYVLTPEGILVETSRDKRNEDWERVWKTKEN
ECEIYGKCGPFGHCNSRDSPICSCLKGYEPKHTQEWNRGNWTGGCVRKTPLQCERTKNGS
EEAKVDGFLKLTNMKVPDLAEQSYALEDDCRQQCLRNCSCIAYSYHTGIGCMWWSGDLID
IQKLSSTGAHLFIRVAHSELKQERRESNCYCYSDYRDNCHCPLHLLHKELFFRNDSQPFK
LEELLLIDFNKLSTATNNFHEANKLGQGGFGPVYRGKLAEGQDIAVKRLSRASTQGLEEF
MNEVVVISKLQHRNLVRLIGCCIEGDEKMLIYEFMPNKSLDASLFG
Download sequence
Identical sequences GSVIVT01006784001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]