SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01006982001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01006982001
Domain Number 1 Region: 340-638
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.26e-68
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Weak hits

Sequence:  GSVIVT01006982001
Domain Number - Region: 127-160
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000644
Family EGF-type module 0.012
Further Details:      
 
Domain Number - Region: 16-58
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00978
Family alpha-D-mannose-specific plant lectins 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01006982001
Sequence length 665
Sequence
MKLGLNRRTGFNRFLTSWKSPTDPGTGENSFGINASGSPQLCLYQGSERLWRTGHWNGLR
WSGVPRMMHNMIINTSFLNNQDEISYMFVMANASVLSRMTVELDGYLQRYTWQETEGKWF
SFYTVPRDQCDRYGRCGLNGNCDNSRAEFECTCLAGFEPKSPRDWSLKDGSAGCLRKEGA
KVCGNGEGFVKVEGVKPPDTSVARVNMNMSLEACREGCLKECSCSGYAAANVSGSGSGCL
SWHGDLVDTRVFPEGGQDLYVRVDAITLGMLAFNCFLAKKGMMAVLVVGATVIMVLLIST
YWFLRKKMKGNQKKNSYGSFKPSIQYSPGAKEHDESTTNSELQFFDLNTIAAATNNFSSE
NELGRGGFGSVYKGQLYNGQEIAVKKLSKDSGQGKEEFKNEVTLIAKLQHVNLVRLLVYP
NIVLLIDILYIFGPDETKRSLLDWRKRFEIIVGIARGILYLHEDSRLRIIHRDLKASNVL
LDAEMLPKISDFGLARIFGGNQMEGNTNRVVGTYGYMSPEYAMEGLFSTKSDVYSFGVLL
LEIITGRKNSTHYRDNPSMNLVGNVWNLWEEDKALDIIDSSLEKSYPTDEVLRCIQIGLL
CVQESAIDQPTMLTIIFMLGNNSALPFPKRPTFISKTTHKGEDLSSSGERLLSVNNVTLT
SLQPR
Download sequence
Identical sequences GSVIVT01006982001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]