SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01007136001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01007136001
Domain Number 1 Region: 99-223
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.65e-32
Family Protein kinases, catalytic subunit 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01007136001
Sequence length 223
Sequence
MDIRTLAQGGQDLFVRVDAIILVENERKKTFFHKKRMIVVLAVGVVFFMISMISASWLIM
KKRKGIEKHCKMSFNMSSKAIRLSHYSKAKELDESGANSKLQFFDLSIVIAATNNFSFTN
KLGRGGFGSVYKGLLSNGQEIAVKRLSKDSGQGVEEFKNEVTLIAKLQHKNLVKLLGCCI
EKEEKMLIYEYLPNKSLDSFIFDETKKSMLAWNKRFEIIIGIA
Download sequence
Identical sequences GSVIVT01007136001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]