SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01007138001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01007138001
Domain Number 1 Region: 191-374
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.59e-57
Family Protein kinases, catalytic subunit 0.00029
Further Details:      
 
Weak hits

Sequence:  GSVIVT01007138001
Domain Number - Region: 48-102
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.018
Family Pan module (APPLE domain) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01007138001
Sequence length 374
Sequence
MRSNLTVDGSIWSAARDPCDNYGRCGLNSNCDVYTGAGFECTCLAGFEPKSQRDCLNLEG
CQKECLNDCNCRAYTSADVSTGGSGCLSWYGDLMDIRTLAQGGQDLFVRVDAIILAENER
TKTFFHKTMMIVILTVGVVFFMIPTICSSWLIMKKRKGKGRQCKTLFNMSSKATRLKHYS
KAKEIDENGENSELQFFDLSIVIAATNNFSFTNKLGRGGFGIVYKGLLSNGQEIAVKRLS
RNSGQGVEEFKNEVTLIAKLQHKNLVKLLGCCIEEEEKMLIYEYLPNKSLDYFIFDETKR
SMLTWRKRFEIIIGIARGILYLHQDSRLRIIHRDLKASNILLDIDMIPKISDFGMARLFG
KNQVEGSTNRVVGT
Download sequence
Identical sequences GSVIVT01007138001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]