SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01007139001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01007139001
Domain Number 1 Region: 61-95
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000706
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01007139001
Sequence length 212
Sequence
MMHRTIINASFLNNQDEISYMFTVVNAPVLSRMTADLDDYLQRYTWQETEGKWFGFYTAP
RDRCDRYSRCGPNSNCDNRHTEFECTCLAGFEPKSPRDWFLKDGSAGCLRKEGAKVCGKG
EGFVKVGGAKPPDTSVARVNMNMSLEACREECLKECSCSGYAAANVSGSGSECLSWHGDL
VDTRVFPEGGQDLYVCVDAITLDILTFNCQDS
Download sequence
Identical sequences GSVIVT01007139001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]