SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01007552001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01007552001
Domain Number 1 Region: 28-125
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.14e-20
Family B3 DNA binding domain 0.0019
Further Details:      
 
Domain Number 2 Region: 465-530
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000334
Family B3 DNA binding domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01007552001
Sequence length 541
Sequence
MDCKEEACLECTKQCLLLHKKKKRPIPNISSFFKVMIGDKFSEILFLPPKFARTVSALVD
EKTHLEDSSGRQWEITVSNLNGSLAFHQGWHAFALDHRLEIGDFVVFHYIMGSHFITQIY
DRTGCEKPKYSENGQHKKITRNKRSPISKDRAFRTIDKGSINEQVSSTSVLSGSDIGIIQ
SQCDATDVEKVPMIVENTSNCKNSNGKLKSVCKAEYVEEPYYIIDRDLGYKRGEYRSSIF
DLSNFEMQNNEFGADGSKKIVAGVEKSPHHADKLLISQTEAMVADVYTVAEEVGRKVVAS
DASKFETGKKKDSDVVEKIILRHNKDSCDNKVSGQFLTTSAEEPGENGKDSSDLGNEGIK
EHQMAEMKIINTHSIDMKGLKKECVEMTSKMHGLEEMIGERALELMKGLHHHSWNPTRKD
NDEVYEVVKTEAVDFIGSPLPIAANLSCIVGTDDRSFLELPASLPSFSYRGRTKMERKVV
VLQDPDKKSWPVLYHERQGFKALTSGWEDFSRANNIQPGDECVFTLENELKGIYAVRIVQ
K
Download sequence
Identical sequences D7SHB6
GSVIVT01007552001 XP_010663041.1.54126 XP_010663042.1.54126 XP_019081883.1.54126 XP_019081884.1.54126 XP_019081885.1.54126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]