SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01009413001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01009413001
Domain Number 1 Region: 477-689
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.61e-53
Family Protein kinases, catalytic subunit 0.00055
Further Details:      
 
Domain Number 2 Region: 123-267
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 7.33e-25
Family alpha-D-mannose-specific plant lectins 0.004
Further Details:      
 
Weak hits

Sequence:  GSVIVT01009413001
Domain Number - Region: 370-413
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0432
Family Hairpin loop containing domain 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01009413001
Sequence length 705
Sequence
MLLETQHDGTSKTWPEGQCEFPPFTPVKESIYFLNSGSTVHLHSPLQISDQETEHINHIP
KLMDRTVGFFVLALLLTCYPSSSETYDTLSEGSSLSVEKSNDLLISANGIFSAGFYQVGN
NTFCFAIWFTKSWGATTVWMANRDQPVNGRGSKLSLLRNGNLLLTDAGKIMVWMINTVST
SSARLQLLNTGNLVLYAWEKTVIWQSFDSPTDTLLPHQILTKDTSLISSRSQSNYSSGFY
KLFFDSDNVIRLLFNGTEVSSIYWPDPSLVTWDAGRSTYNNSRIAVFDSLGYYRASDDLE
FRGTWSVSWQAISQPCQIHGICGPNSLCSYTPAYGRGCSCMPGFKIVNSTDWSYGCAPET
DIACNQTEVGFFPLPHVQLYGYDYGHYPNYTYESCENLCLQLCKCKAFLLNFSDGLYGSS
LFPRYDPLEEFTINCSGNTLSTMQGYILVANGFKRFSYAELKKATRGFTQEIGRGEGKHR
LLVYEYMEHGSLAQKLSSNTLDWEKRFQIALGTARGLAYLHEECLEWVLHCDVKPQNILL
DSNYQPKVADFGMSKLRNRGGLDNSSFSRIRGTRGYMAPEWVFNLPITSKVDVYSYGIVV
LEMVTGKSPTAIPDTDAQGETEQRGLIKWVRDRMNGIGARGSWIEDILDPVMQGECDLRR
MEILIGVALECVEEDRDSRPTMSQIVEKLMCPEERPEEDGYLSMS
Download sequence
Identical sequences GSVIVT01009413001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]