SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01009865001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01009865001
Domain Number 1 Region: 135-277
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.57e-46
Family B3 DNA binding domain 0.0054
Further Details:      
 
Domain Number 2 Region: 813-876
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000019
Family PB1 domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01009865001
Sequence length 907
Sequence
MMSSVEENIKAGGLVSGTQTTLIEEMKLLKEMQDQSGPRKAINSELWHACAGPLVSLPQV
GSLVYYFPQGHSEQVAVSTKRTATSQIPNYPNLPSQLMCQVHNVTLHADKDTDEIYAQMS
LQPVNSEKDIFPIPDFGLKPSKHPSEFFCKTLTASDTSTHGGFSVPRRAAEKLFPPLDYS
MQPPTQELIVRDLHDITYTFRHIYRGQPKRHLLTTGWSVFVSAKRLRAGDAVLFIRDEKS
QLLLGVRRANRQQTSLPSSVLSADSMHIGVLAAAAHAAANRSPFTIFYNPRHAFFLACPS
EFVIPLAKYRKSVYGTQISVGMRFGMMFETEESGKRRYMGTIVGISDLDPLSWPGSKWRN
LQVEWDESGCGDKQSRVSSWEIETPESLFIFPSLTSSLKRPMHAGFLGGEAEWGSLMKRP
FIRVLENGNGVLPYPTIPNICSEQLMKMLLKPQLVNPPGTLTPAFQDSGVKAASLQEARI
IEGMIKQQPPPIPSENKLLQNQNHPQPCLDQPDATNSDLPSQPNLVGQVQPLNKLENQTP
SGNAEKSNIEPVHTADQLSQLTSTGQGDEEKLAKSPKNPQNLTNSFMQPHLESSIFHAQQ
ISAPPFDSNPNALSPYIDTDEWILYPSANQSFGGVLRSPGPLSTFSLQDPSVVFPEAINP
TLPSMGQEIWDHQLNNAKYLSDDSNNQSGIYSCLNFDVSNGGSTVVDPSVSSTILDEFCT
FKDADFPDPSDCLVGNFSTSQDVQSQITSVSLADSQAFSRPDFLDNSGGTSSSNVDFDES
SLLQNSSWQQVAPPPMRTYTKVQKMGSVGRSIDVASFKNYEELCSAIECMFGLEGLLNDQ
KGSGWKLVYVDYENDVLLVGDDPWKEFVGCVRCIRILSPSEVQQMSEEGMQLLNSTAIEG
INDSIRR
Download sequence
Identical sequences GSVIVT01009865001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]