SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01011620001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01011620001
Domain Number 1 Region: 456-748
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.51e-74
Family Protein kinases, catalytic subunit 0.00017
Further Details:      
 
Domain Number 2 Region: 69-193
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000000000131
Family alpha-D-mannose-specific plant lectins 0.0061
Further Details:      
 
Weak hits

Sequence:  GSVIVT01011620001
Domain Number - Region: 260-291
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00172
Family EGF-type module 0.05
Further Details:      
 
Domain Number - Region: 307-353
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0844
Family Pan module (APPLE domain) 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01011620001
Sequence length 820
Sequence
MALPFLCSVLIFTFLFCNPPPLSAQPQQNISNFSSSDSPWRPSQGQILLSPNSTFAAGFW
PTPTSPNLYIFSIWYLNISVHTDIWSANANSPVSGNGTVSITASGELRLVDSSGKNLWPG
NATGNPNSTKLVLRNDGVLVYGDWSSFGSPTDTILPNQQINGTRLVSRNGKYKFKNSMRL
VFNDSDSYWSTANAFQKLDEYGNVWQENGEKQISSDLGAAWLRRLTLDNDGNLRVYSFQG
GVDGWVVVWLAVPEICTIYGRCGANSICMNDGGNSTRCTCPPGFQQRGDSCDRKIQMTQN
TKFLRLDYVNFSGGADQNNLGVQNFTICESKCLANRDCLGFGFKYDGSGYCVLQLKRLLY
GYWSPGTETAMYLRVDNSESDQSNFTGMTDLLETTCPVRISLPLPPEESNTTTRNIVIIC
TLFAAELISGVLFFSAFLKKYIKYRDMARTLGLEFLPAGGPKRFTYAELKAATNDFSDCV
GKGGFGDVYKGELPDHRIVAVKCLKNVTGGDPEFWAEVTIIARMHHLNLVRLWGFCAEKG
RRILVYEYVPKGSLDKFLFPAHWNIRYRIALGVARAIAYLHEECLEWVLHCDIKPENILL
GDDFCPKISDFGLAKLKKKEDMVSMSRIRGTRGYMAPEWVKMDPITPKADVYSFGMVLLE
IVSGRRNNEIQDSLTQSEDWYFPRWAFDKVFKEMRVEDILDSQIIHCYDSRLHFDMVDRM
VKTAMWCLQDRPEMRPSMGKVAKMLEGTKILPLPPHLIIISLTCFHTCVLRYFFPCFHIH
VFRVFLLSTNTRKLIFFSCIIFHNFIIVAFSESFLYHSNF
Download sequence
Identical sequences GSVIVT01011620001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]