SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01012125001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  GSVIVT01012125001
Domain Number - Region: 20-62
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000132
Family B-box zinc-binding domain 0.0054
Further Details:      
 
Domain Number - Region: 34-137
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0889
Family Growth factor receptor domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01012125001
Sequence length 236
Sequence
MVMKPAWLDGLMAETFFAGCGVHENRRKNEKNVFCLECCQSICPHCLPSHRSHPLLQVRR
YVYHDVVRLDDLEKLINCSYIQPYTINSAKVIFLNQRPQSRSCKGSANICFTCDRILQEP
FRFCSISCKVDYMVYQGEDLSSIIYRFDESDFAYSQFEGLRMEDEEGQITPNSILEDPLQ
FKASSCSSNETSGNSGISRDPEAVVRKKKKSTGFLPGNFLSLSSRRKGAPHRSPLS
Download sequence
Identical sequences GSVIVT01012125001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]