SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01012164001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01012164001
Domain Number 1 Region: 651-736
Classification Level Classification E-value
Superfamily PA domain 0.000000209
Family PA domain 0.0093
Further Details:      
 
Weak hits

Sequence:  GSVIVT01012164001
Domain Number - Region: 452-536
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000195
Family Extended AAA-ATPase domain 0.071
Further Details:      
 
Domain Number - Region: 310-334
Classification Level Classification E-value
Superfamily HAD-like 0.0148
Family Meta-cation ATPase, catalytic domain P 0.018
Further Details:      
 
Domain Number - Region: 1074-1123
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0193
Family EGF-type module 0.039
Further Details:      
 
Domain Number - Region: 315-436
Classification Level Classification E-value
Superfamily HAD-like 0.0311
Family Meta-cation ATPase, catalytic domain P 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01012164001
Sequence length 1197
Sequence
MPEKLVAQLKKNGGQFRHLVHHIPYRDITASAILSYDFPLESFPRKHLDYILSFHQVNVP
EVILYLLKASQQLPGRVQVQGKQWLLGNQDLHSQEPNDHESLVQCKAFFMMGNSRTMERT
GLNASHSRVIIAKIGSYVLFAILQPADDQCGTHNRSQELPNFTRFRLCILDPTQTDPLTC
SPPPTYFLNRQTASKAVLKPPAAKRLRHHQSTSPTIPKFLSLLLPDVKAPPSMHLMKVTT
SHYQSRLKQSHSRHSLHSLCIPHTHSSLNLPMHATTLLIPTNPLLMADTPLITFPHSSIL
PLSAITKRMTAIEKMAGMDVLCSDKTGTLTFNKLIRKIVLRATHFSHSGIKKLSPEVALQ
TGESKGPIFLCHSQSSQGSYAKLPSNIKVKRKSMNPDLAGGMADRAERYDNRFNVWIQEV
RTEAYAIEDVLDLFRLHWDQESVWRHLKMWHSISNLIQDINTRLAIISEDVWESIRLALP
DGNDNRIIITTRRGDISNSFRDDDSIDIHKVQPLSPHWAEQLFYKKAFSGSLELSLLSTC
RVVGCEHWAVSSFFSCFSLSSICMVSSMAGLRHQLGLFLVVGMVVMRCAWGRFVVEKNSI
SVLAPLDMRSKHDGAIGNFGIPEYGGSMVGSVVYPQKGSFGCVPFEGDKPFKSRSSPTTI
LLLDRGECYFALKAWNAQQAGAAAVLVADSIDEPLITMDSPEESTDSDGYVEKLRIPSAL
IDRAFGENLKQALKKGQDVLVKLDWTESMPHPDERVEYELWTNSNDECGTRCDEQMNFVQ
NFKGHAQILEKLGYTQFTPHYITWYCPQAFVLSNQCKSQCINHGRYCAPDPEQNFGEGYQ
GKDVVFENLRQLCVHRVANESNRSWVWWDYVTDFHIRCSMKEKRYSKECAEDVMKSLDLP
IDKIKKCMGNPEADVDNEVLKTEQELQVGRGSRGDVTILPTLVVNNIQYRGKLERTAVLK
AICAGFKETTEPQVCLSGDLETNECLERHGGCWHDSRSNITACKDTYRGRVCKCPVVDGV
QYRGDGYVSCEAFGPARCAMNNGGCWSDTKNGKTFSACSDSEVTGCQCPHGFQGDGHKCE
DVNECKERLACQCDGCTCKNTWGGYDCKCKGNLLYIMEQDTCIERSGSKFGWSLGFLVLA
ALVGAGIAGYIFYKYRLRSYMDSEIMAIMSQYMPLDNHNNNNEVPTEAQALRPGSSV
Download sequence
Identical sequences GSVIVT01012164001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]