SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01013232001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  GSVIVT01013232001
Domain Number - Region: 90-118
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0474
Family Merozoite surface protein 1 (MSP-1) 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01013232001
Sequence length 383
Sequence
MASTPRKRPKPHSKSTHSPSSSSSLNALMEPPENFFPSKPELFKLLAVIAIATSVAALCN
YVVTILSRHSKPFCDTNADSQYLPSDLCEPCPSNAECYQGMMECVRGYRKHGKLCIEDGD
INETAKKLANRIETHVCEGYAQFLCGTGSVWVQEDEVWNDVDELKMMENLGLENAIDMHT
KQRAMEMIDGLLETKINHRGIKELKCPNLLAEHYKPFSCRVQQWISNHALVLMPICGLLV
GSILLLRRIRQRRNLSARAEELYNQICDILEENAMMTKGGDGEGEPWVVVSWLRDHLLLP
KERKDPLLWRKVEELVQEDSRLDRYPKLVKGESKVVWEWQVEGSLSSRLRKKREASKLKP
SGGTNINSGVQSPAMKASEMVNC
Download sequence
Identical sequences D7TTG5
GSVIVT01013232001 29760.GSVIVG00015822001 XP_019080384.1.54126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]