SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01014328001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01014328001
Domain Number 1 Region: 435-721
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.09e-78
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 
Domain Number 2 Region: 64-179
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.01e-16
Family alpha-D-mannose-specific plant lectins 0.0068
Further Details:      
 
Domain Number 3 Region: 310-365
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0000143
Family Pan module (APPLE domain) 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01014328001
Sequence length 751
Sequence
MGIRVQTGFFFLHVLVLFFLSFYMHLSIGVDTIFPGQPISGNQTITSQDERFELGFFKPN
NSQNYYIGIWYKKVPVHTVVWVANRYKPLADPFSSKLELSVNGNLVVQNQSKIQVWSTSI
ISSTLNSTFALTKKQQIYSSWSSYDDPAPGPFLLKLDPNGTRQYFIMWNGDKHWTCGIWP
GRVSVFGPDMLDDNYNNMTYVSNEEENYFTYSVTKTSILSRFVMDSSGQLRQLTWLEDSQ
QWKLIWSRPQQQCEIYALCGEYGGCNQFSVPTCKCLQGFEPRFPTEWISGNHSHGCVRTT
PLQCRKGGKDGFRMIPNIRLPANAVSLTVRSSKECEAACLENCTCTAYTFDGECSIWLEN
LLNIQYLSFGDNLGKDLHLRVAAVELVVYRSRTKPRINGDIVGAAAGVATLTVILGFIIW
KCRRRQFSSAVKPTEDLLVLYKYSDLRKATKNFSEKLGEGGFGSVFKGTLPNSAEIAAKK
LKCHGQGEKQFRAEVSTIGTIHHINLIRLRGFCLEGTKRFLVYEYMPNGSLESHLFQKSP
RILDWKTRCQIALGIARGLEYLHEKCRDCIIHCDIKPENILLDAGYNPKISDFGLAKLLG
RDFSRVLTTVKGTRGYLAPEWISGIAITAKADVFSYGMMLFEIISGRRNWEIKDDRMNDY
FPAQVMKKLSRGEELLTLLDEKLEQNADIEELTRVCKVACWCIQDDEGDRPSMKSVVQIL
EGALNVIMPPIPSFIENIAENPEEGSPTPGF
Download sequence
Identical sequences E0CSJ3
GSVIVT01014328001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]