SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01014481001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01014481001
Domain Number 1 Region: 367-568
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.32e-50
Family Protein kinases, catalytic subunit 0.001
Further Details:      
 
Domain Number 2 Region: 248-302
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0000184
Family Pan module (APPLE domain) 0.088
Further Details:      
 
Domain Number 3 Region: 57-108
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000288
Family alpha-D-mannose-specific plant lectins 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01014481001
Sequence length 594
Sequence
MAIRLLMGCVNASYELWVAWNFQPEDTILQGQSITTSQTIISAAGNFELGFFKPGNSTNY
YVGIWYKKISDQVSDKTIAWVANREYAFKNPSVVLTVSTDGNLEILEGKFAYKVQAYHQI
ETQVPPCWILEMFWTSGIWDGRTFSLAPEMLEDYIFNYSYYSSKDESYWSYSLYDSSIIS
RLVLDVSGQIKQRKWLDSSHQWNLFWARPRTKCEVYASCGPFGICHESAVDGFCECLPGF
EPVSPNNWYSDEGVTLPNYPLTLPARSAQECKSACLNNCSCSAYAYDRETCTVWSGDLLN
LRQPSHYNSSGQDFYLKLAASELNGKGNKSRECSKWKVWLIVILAISLTSAFVIWGIWRK
LRRKDPAKHGILNWKTWVHIIEGVAQGLLYLHQYSRLRIIHRDLKASNILLDKDMNPKIS
DFGMVRIFGSNESKATNHIVGTYGYMSPEYALEGLFSTKSDVFSFGVLLLEILSGKKNTE
FYQSDSLNLLGYAWDLWKDNRGQELMDPVLEETLPTHILLKYINIGLLCVQESADDRLTM
SDVVSMLGNESVRLPSPKQPAFSNLRSGVAPHIFQNRPEICSLNGVTLSIMEAR
Download sequence
Identical sequences GSVIVT01014481001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]