SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01014482001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01014482001
Domain Number 1 Region: 240-544
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.52e-84
Family Protein kinases, catalytic subunit 0.00012
Further Details:      
 
Weak hits

Sequence:  GSVIVT01014482001
Domain Number - Region: 90-145
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000133
Family Pan module (APPLE domain) 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01014482001
Sequence length 570
Sequence
MATSRFWRGSFRTRYWTTGVWDGQIFSQIPELRFYYFYKYNTSFNENESYFTYSFHDPSI
LSRVVVDVSGGCVRKEDLQCVNESHANGERDQFLLVSNVRLPKYPVTLQARTAMECESIC
LNRCSCSAYAYEGECRIWGGDLVNVEQLPDGDSNARSFYIKLAASELNKRVSTSKWKVWL
IVTLAISLTSVFVNYGIWRRFRRKGEDLLVFDFGNSSEDTNCYELGETNRLWRDEKKEVD
LPMFSFASVSASTNNFCIENKLGEGGFGSVYKGKSQRGYEVAVKRLSKRSKQGWEELKNE
AMLIAKLQHKNLVKVLGYCIERDEKILIYEYMSNKSLDFFLFDPAKRGILNWETRVHIIE
GVAQGLLYLHQYSRLRVIHRDLKASNILLDKDMNPKISDFGMARIFGGNESKATKHIVGT
YGYMSPEYVLRGLFSTKSDVFSFGVLLLEILSGKKITEFYHSDSLNLLGYAWDLWKSNRG
QELIDPVLNEISLRHILLRYINVALLCVQESADDRPTMSDVVSMLVKENVLLSSPNEPAF
LNLSSMKPHASQDRLEICSLNDLTRLNRSC
Download sequence
Identical sequences GSVIVT01014482001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]