SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01014485001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01014485001
Domain Number 1 Region: 342-651
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-83
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 
Weak hits

Sequence:  GSVIVT01014485001
Domain Number - Region: 15-58
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000128
Family alpha-D-mannose-specific plant lectins 0.0066
Further Details:      
 
Domain Number - Region: 191-245
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000129
Family Pan module (APPLE domain) 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01014485001
Sequence length 674
Sequence
MKLGYDKRAGKTWSLVSWKSAEDPSPGDFSLQVDPNGTSQIFSLQGPNRYWTTGVWDGQI
FTQVPEMRLPDMYKCNISFNENEIYLTYSLHNPSILSRLVLDVSGQIRSLNWHEGTREWD
LFWLQPKTQCEVYAYCGPFGTCTRDSVEFCECLPGFEPRFPEDWNLQDRSGGCVRKADLQ
CVNESHANGERDQFLLVSNVRLPKYPVTLQARSAMECESICLNRCSCSAYAYKRECRIWA
GDLVNVEQLPDGDSNGRSFYIKLAASELNKRGKKKDSKWKVWLIITLAISLTSAFVIYGI
WGRFRRKGEDLLVFDFGNSSEDTSYELDETNRLWRGEKREVDLPMFSFASVSASTNNFSI
ENKLGEGGFGSVYKGKSQRRYEVAVKRLSKRSKQGWEELKNEAMLIAKLQHKNLVKVLGY
CIERDEKILIYEYMSNKSLDFFLFDPTKHGILNWKTRVHIIEGVAQGLLYLHQYSRLRII
HRDLKASNILLDKDMNPKISDFGMARIFGGNESKVTNHIVGTYGYMSPEYALEGLFSTKS
DVFSFGVLLLEILSGKKNTGFYQTDSLNLLGYAWDLWKDSRGLELMDPGLEETLPTHILL
RYINVGLLCVQESADDRPTMSDVVSMLGNESVRLPSPKQPAFSNLRSGVEPHISQNRPEV
CSLNGVTLSVMEAR
Download sequence
Identical sequences GSVIVT01014485001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]