SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01014490001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01014490001
Domain Number 1 Region: 501-606
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.81e-27
Family Protein kinases, catalytic subunit 0.0023
Further Details:      
 
Domain Number 2 Region: 108-211
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 7.59e-26
Family alpha-D-mannose-specific plant lectins 0.0096
Further Details:      
 
Domain Number 3 Region: 353-410
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0000255
Family Pan module (APPLE domain) 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01014490001
Sequence length 607
Sequence
MSWISSTTAVMMNVIKERMEEERQNEVYIFSILRCMVKISSCTSIGARYSSIATTQCFMD
TILQGQSLITSQTIISAGGNFELGFFSPGKSTKYYVGIWYKKISEQTIVWVANRDYPFTN
PSVVLTVSTDGNLEILEGKFSYKVTSISSSSNTSATLLDSGNLVLRNKRSDVLWESFDYP
SDTLLPGMKLGYDKRAGKTWSMVSWKSAEDPSPGDFSVQVDPNGTSQFFSQQGPNRYWTS
GVWDGQIFGQVPEMRFFYMYKYNTSFNENESYFTYSLNNPSILSRVVLDVSGQIRHLNCQ
EGTHEWDLSWLHPRTQCFEPRFLEDWNLQDRSGGCVRKADLECVNESHANGERDQFLLVS
NVRLPKYPVTIQARSAMECESICLNSCPCSAYAYEGDECRIWGGDLVNVEQLPDGDSNAR
SFYIKLAASELNKRVSSSKWKVWLIVTLAVSLTSVFVNYGIWRRFRRKGEDLLVFDFGNS
SEDTSYELGETNRLWRGEKKEVDLPRFSFASASASTNNFSIENKLGEGGFGSVYKGKSQR
GYEVAVKRLSKRSKQGWEELKNEVMLIAKLQHKNLVRVLGYCTERDEKILIYEYMSNKSL
DFFLFGL
Download sequence
Identical sequences GSVIVT01014490001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]